Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A6R5B1

Protein Details
Accession A6R5B1    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
25-52EDQGPQKQQGKRRLRRRKRERRGEGGSTBasic
NLS Segment(s)
PositionSequence
30-47QKQQGKRRLRRRKRERRG
Subcellular Location(s) nucl 11, mito 7, cyto 7, cyto_mito 7
Family & Domain DBs
KEGG aje:HCAG_04819  -  
Amino Acid Sequences MGFKGCEVEPRLVGTSELQREKRHEDQGPQKQQGKRRLRRRKRERRGEGGSTPAQAGWWWLGWMGQDGKGVLGIVMYCNIGESAAHNLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.29
4 0.35
5 0.35
6 0.36
7 0.4
8 0.46
9 0.5
10 0.5
11 0.47
12 0.49
13 0.57
14 0.64
15 0.69
16 0.68
17 0.68
18 0.65
19 0.69
20 0.71
21 0.71
22 0.7
23 0.73
24 0.78
25 0.82
26 0.89
27 0.92
28 0.93
29 0.93
30 0.95
31 0.92
32 0.89
33 0.85
34 0.8
35 0.7
36 0.64
37 0.54
38 0.43
39 0.35
40 0.26
41 0.19
42 0.13
43 0.12
44 0.07
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.09
51 0.1
52 0.1
53 0.11
54 0.11
55 0.11
56 0.11
57 0.11
58 0.08
59 0.07
60 0.05
61 0.05
62 0.06
63 0.06
64 0.05
65 0.06
66 0.06
67 0.06
68 0.06
69 0.07