Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6R2M1

Protein Details
Accession A6R2M1   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
15-39KIPWRLSAPQKARQRKRLRAVDKVVHydrophilic
73-102DKYTIFDRKEKKYRKGIHKLPKWTRVSQRVHydrophilic
NLS Segment(s)
PositionSequence
81-94KEKKYRKGIHKLPK
Subcellular Location(s) mito 21.5, cyto_mito 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG aje:HCAG_03879  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKPTSPVMGGLLWKIPWRLSAPQKARQRKRLRAVDKVVDTVSAALERNGMTSKAVARWFEEMPREEEMLAKDKYTIFDRKEKKYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.16
5 0.2
6 0.26
7 0.32
8 0.42
9 0.46
10 0.54
11 0.64
12 0.72
13 0.77
14 0.8
15 0.82
16 0.81
17 0.85
18 0.86
19 0.83
20 0.81
21 0.79
22 0.76
23 0.68
24 0.6
25 0.49
26 0.39
27 0.32
28 0.23
29 0.16
30 0.09
31 0.08
32 0.06
33 0.06
34 0.06
35 0.07
36 0.07
37 0.07
38 0.06
39 0.07
40 0.08
41 0.1
42 0.12
43 0.12
44 0.12
45 0.15
46 0.15
47 0.17
48 0.19
49 0.18
50 0.19
51 0.21
52 0.2
53 0.17
54 0.18
55 0.18
56 0.19
57 0.18
58 0.15
59 0.15
60 0.15
61 0.17
62 0.2
63 0.25
64 0.23
65 0.33
66 0.39
67 0.48
68 0.57
69 0.64
70 0.68
71 0.73
72 0.79
73 0.8
74 0.85
75 0.85
76 0.86
77 0.86
78 0.89
79 0.88
80 0.88
81 0.83
82 0.8
83 0.8
84 0.8
85 0.8
86 0.77
87 0.79