Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6RCN9

Protein Details
Accession A6RCN9    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
22-50VNVPKTRRTYCKSKECRKHTQHKVTQYKAHydrophilic
NLS Segment(s)
PositionSequence
79-83RKKAK
Subcellular Location(s) mito 15, nucl 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG aje:HCAG_07397  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MSPAISSFSLRGAESAKSSQNVNVPKTRRTYCKSKECRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFRKKAKTTKKVVLRLECTVCKTKAQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.22
4 0.21
5 0.22
6 0.24
7 0.28
8 0.33
9 0.34
10 0.38
11 0.39
12 0.42
13 0.48
14 0.51
15 0.52
16 0.53
17 0.59
18 0.6
19 0.68
20 0.73
21 0.77
22 0.82
23 0.82
24 0.87
25 0.86
26 0.87
27 0.87
28 0.87
29 0.84
30 0.84
31 0.85
32 0.78
33 0.77
34 0.7
35 0.64
36 0.55
37 0.5
38 0.39
39 0.31
40 0.3
41 0.29
42 0.28
43 0.25
44 0.31
45 0.34
46 0.38
47 0.42
48 0.46
49 0.43
50 0.49
51 0.57
52 0.54
53 0.56
54 0.55
55 0.55
56 0.54
57 0.57
58 0.49
59 0.45
60 0.42
61 0.37
62 0.4
63 0.42
64 0.43
65 0.38
66 0.46
67 0.52
68 0.59
69 0.67
70 0.7
71 0.71
72 0.73
73 0.8
74 0.79
75 0.76
76 0.73
77 0.68
78 0.64
79 0.62
80 0.55
81 0.5
82 0.48
83 0.41
84 0.36
85 0.33
86 0.32
87 0.36
88 0.42
89 0.44
90 0.47
91 0.57
92 0.64
93 0.69
94 0.66
95 0.61
96 0.56
97 0.51
98 0.5
99 0.5
100 0.51
101 0.52
102 0.55
103 0.52
104 0.5
105 0.49
106 0.42