Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A6R7Y2

Protein Details
Accession A6R7Y2    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
217-242RVEVLERRDREKRRRLERLEKAIERVBasic
NLS Segment(s)
PositionSequence
222-236ERRDREKRRRLERLE
Subcellular Location(s) nucl 12, mito 11, cyto_nucl 8.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR040351  RAB3IL/RAB3IP/Sec2  
IPR009449  Sec2_N  
Gene Ontology GO:0005085  F:guanyl-nucleotide exchange factor activity  
KEGG aje:HCAG_06423  -  
Pfam View protein in Pfam  
PF06428  Sec2p  
Amino Acid Sequences MTTITTIRSKTSTTAPVVGDMISTVAKRTTAATTATDCPNCGYDVFLADDHAHHQRISELEAQIRFLNKKSPQGPQHQQHNQQPQSKQTTPTLPPSQTTDHHIHPASPPTPQSRLGTFASLLPYGRRNATTPPPQNRSPSPTSTTRPPTSHSTSSHAPQPSKALQDALTREQTLRKEAESRLTQANSELEELTAQLFSQANEMVAQERKARAKLEERVEVLERRDREKRRRLERLEKAIERVDRVRGIVGDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.34
3 0.34
4 0.33
5 0.29
6 0.23
7 0.16
8 0.14
9 0.1
10 0.1
11 0.09
12 0.09
13 0.09
14 0.1
15 0.12
16 0.13
17 0.15
18 0.17
19 0.18
20 0.22
21 0.26
22 0.31
23 0.29
24 0.27
25 0.26
26 0.25
27 0.23
28 0.19
29 0.16
30 0.11
31 0.13
32 0.14
33 0.13
34 0.13
35 0.12
36 0.13
37 0.14
38 0.18
39 0.17
40 0.15
41 0.15
42 0.16
43 0.16
44 0.19
45 0.21
46 0.19
47 0.22
48 0.23
49 0.24
50 0.23
51 0.25
52 0.23
53 0.19
54 0.26
55 0.25
56 0.33
57 0.35
58 0.42
59 0.45
60 0.54
61 0.62
62 0.62
63 0.69
64 0.69
65 0.73
66 0.73
67 0.77
68 0.74
69 0.71
70 0.65
71 0.62
72 0.62
73 0.57
74 0.52
75 0.45
76 0.45
77 0.41
78 0.47
79 0.45
80 0.37
81 0.36
82 0.37
83 0.36
84 0.31
85 0.33
86 0.29
87 0.25
88 0.29
89 0.28
90 0.25
91 0.24
92 0.28
93 0.23
94 0.2
95 0.21
96 0.2
97 0.23
98 0.25
99 0.24
100 0.2
101 0.24
102 0.23
103 0.21
104 0.18
105 0.17
106 0.16
107 0.14
108 0.13
109 0.1
110 0.11
111 0.12
112 0.12
113 0.12
114 0.12
115 0.15
116 0.22
117 0.3
118 0.36
119 0.42
120 0.46
121 0.48
122 0.51
123 0.5
124 0.49
125 0.44
126 0.4
127 0.37
128 0.37
129 0.38
130 0.41
131 0.45
132 0.43
133 0.4
134 0.4
135 0.42
136 0.43
137 0.45
138 0.4
139 0.38
140 0.37
141 0.38
142 0.4
143 0.37
144 0.32
145 0.28
146 0.31
147 0.28
148 0.28
149 0.27
150 0.22
151 0.21
152 0.25
153 0.27
154 0.26
155 0.25
156 0.24
157 0.24
158 0.27
159 0.26
160 0.25
161 0.23
162 0.21
163 0.23
164 0.24
165 0.31
166 0.3
167 0.31
168 0.33
169 0.32
170 0.31
171 0.28
172 0.28
173 0.21
174 0.2
175 0.17
176 0.11
177 0.11
178 0.11
179 0.09
180 0.08
181 0.06
182 0.07
183 0.07
184 0.07
185 0.09
186 0.09
187 0.09
188 0.09
189 0.1
190 0.11
191 0.13
192 0.15
193 0.17
194 0.22
195 0.25
196 0.28
197 0.3
198 0.32
199 0.39
200 0.45
201 0.48
202 0.5
203 0.48
204 0.49
205 0.51
206 0.48
207 0.44
208 0.43
209 0.38
210 0.38
211 0.46
212 0.51
213 0.57
214 0.64
215 0.71
216 0.74
217 0.83
218 0.86
219 0.88
220 0.89
221 0.89
222 0.89
223 0.82
224 0.76
225 0.72
226 0.66
227 0.6
228 0.53
229 0.48
230 0.4
231 0.37
232 0.36