Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BLU9

Protein Details
Accession I1BLU9    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-41APSLRRKLVSECRPKRKPKQYKASQQLQQTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MDLPIQEKPNLAPSLRRKLVSECRPKRKPKQYKASQQLQQTMALLEDELNTTTVYSTPYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.48
3 0.48
4 0.42
5 0.47
6 0.57
7 0.58
8 0.61
9 0.61
10 0.68
11 0.75
12 0.82
13 0.85
14 0.86
15 0.87
16 0.85
17 0.87
18 0.86
19 0.88
20 0.88
21 0.86
22 0.8
23 0.74
24 0.7
25 0.6
26 0.51
27 0.41
28 0.32
29 0.23
30 0.18
31 0.13
32 0.08
33 0.07
34 0.07
35 0.07
36 0.08
37 0.07
38 0.07
39 0.08
40 0.08