Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3S039

Protein Details
Accession E3S039    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
7-28PPPHLLIHKREKKKEESKKDMDBasic
NLS Segment(s)
PositionSequence
15-20KREKKK
Subcellular Location(s) mito 15.5, mito_nucl 12.333, nucl 8, cyto_nucl 6.333
Family & Domain DBs
KEGG pte:PTT_15386  -  
Amino Acid Sequences MSSFQHPPPHLLIHKREKKKEESKKDMDLDPRTFFNTPHHTVFTHIRNIPPTHPNASMLGFTRFNRHTFPHMTVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.69
3 0.73
4 0.72
5 0.76
6 0.8
7 0.82
8 0.81
9 0.81
10 0.78
11 0.78
12 0.75
13 0.69
14 0.66
15 0.61
16 0.53
17 0.45
18 0.4
19 0.35
20 0.32
21 0.28
22 0.27
23 0.27
24 0.27
25 0.27
26 0.28
27 0.25
28 0.28
29 0.32
30 0.3
31 0.29
32 0.27
33 0.27
34 0.3
35 0.32
36 0.32
37 0.32
38 0.32
39 0.3
40 0.3
41 0.3
42 0.27
43 0.27
44 0.25
45 0.22
46 0.23
47 0.22
48 0.21
49 0.27
50 0.28
51 0.28
52 0.3
53 0.32
54 0.35
55 0.37