Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BVT8

Protein Details
Accession I1BVT8    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
57-81MELIKNSKDKRAKKLCKSKLGTFVRHydrophilic
NLS Segment(s)
PositionSequence
64-76KDKRAKKLCKSKL
81-84RAKK
Subcellular Location(s) mito 15, nucl 6, cyto 6, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MAATGIAVGINKGHITARRTLKAKPSNKIGAASKRTTFVKSIVREVAGYAPYERRLMELIKNSKDKRAKKLCKSKLGTFVRAKKKIEELQGVIAASRRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.17
3 0.25
4 0.32
5 0.39
6 0.41
7 0.44
8 0.52
9 0.57
10 0.61
11 0.59
12 0.6
13 0.59
14 0.58
15 0.59
16 0.55
17 0.54
18 0.53
19 0.5
20 0.43
21 0.4
22 0.4
23 0.37
24 0.32
25 0.27
26 0.29
27 0.28
28 0.3
29 0.28
30 0.26
31 0.25
32 0.24
33 0.21
34 0.14
35 0.13
36 0.1
37 0.1
38 0.11
39 0.11
40 0.11
41 0.09
42 0.1
43 0.12
44 0.15
45 0.22
46 0.27
47 0.31
48 0.39
49 0.39
50 0.45
51 0.52
52 0.54
53 0.56
54 0.62
55 0.67
56 0.7
57 0.81
58 0.82
59 0.84
60 0.85
61 0.81
62 0.8
63 0.77
64 0.75
65 0.73
66 0.73
67 0.73
68 0.73
69 0.69
70 0.63
71 0.65
72 0.63
73 0.61
74 0.59
75 0.51
76 0.49
77 0.49
78 0.45
79 0.37