Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BLG2

Protein Details
Accession I1BLG2    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-32LPIQRKVTEKSNKPRTRRIEHydrophilic
67-87VDECRPKRKSRQSQQVAQQTMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR001969  Aspartic_peptidase_AS  
Gene Ontology GO:0004190  F:aspartic-type endopeptidase activity  
GO:0006508  P:proteolysis  
PROSITE View protein in PROSITE  
PS00141  ASP_PROTEASE  
Amino Acid Sequences MQATRTEAMDTDLPIQRKVTEKSNKPRTRRIEPDIKYDIISDVLKQKADIEIGDLITVAPSLRKKLVDECRPKRKSRQSQQVAQQTMALIEDEEINTTAAYSTVSIGDKNIKALVDSGASKTCM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.25
4 0.29
5 0.31
6 0.35
7 0.4
8 0.48
9 0.58
10 0.69
11 0.74
12 0.75
13 0.81
14 0.8
15 0.79
16 0.78
17 0.75
18 0.74
19 0.69
20 0.71
21 0.66
22 0.58
23 0.49
24 0.4
25 0.33
26 0.25
27 0.22
28 0.15
29 0.16
30 0.16
31 0.16
32 0.15
33 0.15
34 0.14
35 0.14
36 0.13
37 0.1
38 0.09
39 0.09
40 0.09
41 0.08
42 0.07
43 0.06
44 0.06
45 0.04
46 0.05
47 0.05
48 0.07
49 0.08
50 0.09
51 0.1
52 0.19
53 0.28
54 0.36
55 0.46
56 0.54
57 0.63
58 0.68
59 0.71
60 0.72
61 0.74
62 0.76
63 0.76
64 0.78
65 0.75
66 0.78
67 0.83
68 0.82
69 0.73
70 0.62
71 0.52
72 0.41
73 0.33
74 0.26
75 0.16
76 0.08
77 0.06
78 0.06
79 0.06
80 0.07
81 0.07
82 0.07
83 0.07
84 0.07
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.08
91 0.09
92 0.09
93 0.11
94 0.17
95 0.17
96 0.18
97 0.2
98 0.17
99 0.17
100 0.18
101 0.18
102 0.16
103 0.17
104 0.18