Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1C9U3

Protein Details
Accession I1C9U3    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-42SDLPIEIKPKPIKRKTKAPPIRYDIVSHydrophilic
NLS Segment(s)
PositionSequence
23-33KPKPIKRKTKA
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
Pfam View protein in Pfam  
PF13975  gag-asp_proteas  
CDD cd00303  retropepsin_like  
Amino Acid Sequences MPKQPIQATGSMEVDSDLPIEIKPKPIKRKTKAPPIRYDIVSDVVNQKADISVGDLMVAAPTLRRKLASACRPKRIPVTETSKETMAVIEEDDIHTTAVYSKINIGDKTVKVLVDCGAAKTCMSKSLADALGLEIDAASESVFTLGNGSKQPALGVIYDVPIEVQEDLIIPCTVEVLPACPTHLIIGNNWLNRAKAKIDFNSSTLKVSYKNKKAEIEIFFLRKNTPLPKISSYIQSYQHPISSTNSKETKKVHFENDKADSEDDEVEEESEESTDEESTEEEEVEDEEHSLLLLENDYKKDIQIKNLKNQCILEASSDGLTIPANSSKTIIIKKPKDELRGLMYSFEITSTKILQKTGILDPCHNFITNKKSLEIRIHNRSNDNIILDPGEEIGILEKLNLKEDTIIQAYDVEKDIHLCTMEMTEAMDKETSDEDKRNFRSRKVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.16
3 0.12
4 0.09
5 0.08
6 0.08
7 0.11
8 0.12
9 0.21
10 0.29
11 0.38
12 0.48
13 0.58
14 0.69
15 0.74
16 0.84
17 0.85
18 0.88
19 0.89
20 0.87
21 0.87
22 0.84
23 0.83
24 0.73
25 0.67
26 0.58
27 0.51
28 0.42
29 0.34
30 0.31
31 0.26
32 0.25
33 0.21
34 0.19
35 0.16
36 0.15
37 0.13
38 0.11
39 0.1
40 0.09
41 0.1
42 0.09
43 0.09
44 0.08
45 0.08
46 0.05
47 0.06
48 0.1
49 0.12
50 0.13
51 0.14
52 0.16
53 0.24
54 0.34
55 0.43
56 0.51
57 0.57
58 0.65
59 0.67
60 0.7
61 0.71
62 0.67
63 0.6
64 0.58
65 0.59
66 0.57
67 0.59
68 0.57
69 0.48
70 0.42
71 0.39
72 0.3
73 0.22
74 0.16
75 0.11
76 0.09
77 0.09
78 0.1
79 0.11
80 0.1
81 0.09
82 0.08
83 0.08
84 0.09
85 0.1
86 0.1
87 0.09
88 0.11
89 0.16
90 0.2
91 0.2
92 0.22
93 0.26
94 0.26
95 0.3
96 0.29
97 0.25
98 0.21
99 0.22
100 0.19
101 0.17
102 0.17
103 0.14
104 0.14
105 0.14
106 0.14
107 0.15
108 0.15
109 0.14
110 0.16
111 0.15
112 0.15
113 0.21
114 0.22
115 0.19
116 0.19
117 0.16
118 0.14
119 0.13
120 0.12
121 0.05
122 0.04
123 0.04
124 0.04
125 0.03
126 0.03
127 0.03
128 0.04
129 0.04
130 0.04
131 0.06
132 0.06
133 0.09
134 0.1
135 0.11
136 0.11
137 0.11
138 0.11
139 0.1
140 0.11
141 0.09
142 0.09
143 0.09
144 0.08
145 0.08
146 0.08
147 0.07
148 0.06
149 0.06
150 0.05
151 0.04
152 0.04
153 0.05
154 0.05
155 0.07
156 0.06
157 0.05
158 0.05
159 0.06
160 0.06
161 0.06
162 0.06
163 0.06
164 0.08
165 0.08
166 0.09
167 0.08
168 0.08
169 0.09
170 0.12
171 0.12
172 0.1
173 0.18
174 0.21
175 0.21
176 0.22
177 0.22
178 0.19
179 0.19
180 0.21
181 0.15
182 0.16
183 0.2
184 0.21
185 0.27
186 0.27
187 0.29
188 0.32
189 0.3
190 0.26
191 0.23
192 0.21
193 0.19
194 0.26
195 0.34
196 0.37
197 0.42
198 0.44
199 0.45
200 0.47
201 0.5
202 0.45
203 0.4
204 0.35
205 0.32
206 0.3
207 0.28
208 0.26
209 0.2
210 0.2
211 0.19
212 0.21
213 0.21
214 0.24
215 0.26
216 0.29
217 0.29
218 0.31
219 0.31
220 0.3
221 0.3
222 0.28
223 0.28
224 0.26
225 0.26
226 0.22
227 0.2
228 0.19
229 0.22
230 0.22
231 0.25
232 0.31
233 0.3
234 0.34
235 0.36
236 0.4
237 0.42
238 0.45
239 0.47
240 0.48
241 0.49
242 0.52
243 0.53
244 0.48
245 0.41
246 0.38
247 0.3
248 0.24
249 0.22
250 0.16
251 0.11
252 0.09
253 0.08
254 0.08
255 0.07
256 0.06
257 0.05
258 0.05
259 0.05
260 0.05
261 0.05
262 0.05
263 0.05
264 0.05
265 0.06
266 0.06
267 0.06
268 0.06
269 0.06
270 0.06
271 0.06
272 0.06
273 0.05
274 0.05
275 0.05
276 0.05
277 0.05
278 0.05
279 0.04
280 0.05
281 0.07
282 0.09
283 0.1
284 0.11
285 0.11
286 0.12
287 0.2
288 0.21
289 0.28
290 0.36
291 0.41
292 0.5
293 0.57
294 0.58
295 0.53
296 0.52
297 0.44
298 0.37
299 0.32
300 0.24
301 0.18
302 0.17
303 0.14
304 0.13
305 0.12
306 0.09
307 0.08
308 0.06
309 0.07
310 0.09
311 0.1
312 0.1
313 0.11
314 0.13
315 0.17
316 0.22
317 0.27
318 0.34
319 0.4
320 0.44
321 0.51
322 0.56
323 0.57
324 0.55
325 0.52
326 0.49
327 0.47
328 0.43
329 0.36
330 0.3
331 0.25
332 0.22
333 0.19
334 0.13
335 0.09
336 0.11
337 0.13
338 0.17
339 0.18
340 0.19
341 0.19
342 0.2
343 0.24
344 0.29
345 0.32
346 0.3
347 0.32
348 0.33
349 0.35
350 0.35
351 0.32
352 0.26
353 0.25
354 0.31
355 0.34
356 0.34
357 0.33
358 0.35
359 0.38
360 0.47
361 0.52
362 0.52
363 0.56
364 0.61
365 0.63
366 0.63
367 0.61
368 0.57
369 0.5
370 0.43
371 0.34
372 0.28
373 0.24
374 0.21
375 0.19
376 0.14
377 0.11
378 0.08
379 0.07
380 0.07
381 0.07
382 0.07
383 0.07
384 0.12
385 0.13
386 0.17
387 0.17
388 0.16
389 0.18
390 0.2
391 0.24
392 0.21
393 0.21
394 0.17
395 0.2
396 0.2
397 0.2
398 0.2
399 0.16
400 0.14
401 0.16
402 0.17
403 0.15
404 0.15
405 0.13
406 0.13
407 0.13
408 0.13
409 0.11
410 0.12
411 0.13
412 0.12
413 0.14
414 0.14
415 0.12
416 0.14
417 0.17
418 0.2
419 0.22
420 0.29
421 0.32
422 0.41
423 0.48
424 0.57
425 0.58