Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BQL0

Protein Details
Accession I1BQL0   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
99-123VEIPGTNQKKRPRRRYDEIERLYHCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039327  CON7-like  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
Amino Acid Sequences MPQQTTTIHPGQFQLNSSSNPILVNNNPSTTADMVAAAAAAASMMSFDPMYAMPTQPGLTTDPVTIINPIEFNNQIINQRTRQSSNASNSSVEKVYSFVEIPGTNQKKRPRRRYDEIERLYHCNWPGCTKAYGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.27
4 0.3
5 0.28
6 0.24
7 0.23
8 0.22
9 0.2
10 0.2
11 0.25
12 0.23
13 0.23
14 0.24
15 0.24
16 0.25
17 0.22
18 0.2
19 0.13
20 0.12
21 0.11
22 0.09
23 0.08
24 0.05
25 0.04
26 0.03
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.03
33 0.03
34 0.03
35 0.04
36 0.04
37 0.06
38 0.07
39 0.07
40 0.07
41 0.08
42 0.08
43 0.07
44 0.09
45 0.09
46 0.09
47 0.1
48 0.1
49 0.1
50 0.11
51 0.11
52 0.1
53 0.08
54 0.07
55 0.07
56 0.07
57 0.08
58 0.08
59 0.08
60 0.09
61 0.1
62 0.13
63 0.16
64 0.18
65 0.19
66 0.22
67 0.24
68 0.25
69 0.26
70 0.28
71 0.31
72 0.34
73 0.36
74 0.34
75 0.33
76 0.32
77 0.33
78 0.29
79 0.22
80 0.17
81 0.13
82 0.12
83 0.13
84 0.12
85 0.09
86 0.11
87 0.11
88 0.13
89 0.23
90 0.28
91 0.29
92 0.36
93 0.45
94 0.52
95 0.63
96 0.72
97 0.73
98 0.77
99 0.84
100 0.88
101 0.89
102 0.9
103 0.86
104 0.83
105 0.75
106 0.72
107 0.63
108 0.57
109 0.49
110 0.44
111 0.4
112 0.36
113 0.37
114 0.35