Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1CW02

Protein Details
Accession I1CW02    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
147-166YNDQSTPQQHKQQQNQPSKNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13.333, cyto 3.5, cyto_pero 2.666
Family & Domain DBs
Amino Acid Sequences MDINGHTNDVQYQVHHRPRYEHKEPTQPDNQHDILNMVQQAIRNELNGFYQPNRSYNRNTRGNPNSYNNNYRDYRHNNEHNGHQNNNGNGYSNNGYNNNGYNNSGYSNNGYSNRANYNNNGYNRYRNNVDYTSRKPEYNNNQPNNNYNDQSTPQQHKQQQNQPSKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.42
3 0.43
4 0.47
5 0.57
6 0.65
7 0.65
8 0.65
9 0.63
10 0.69
11 0.71
12 0.71
13 0.7
14 0.64
15 0.61
16 0.58
17 0.53
18 0.43
19 0.4
20 0.34
21 0.25
22 0.24
23 0.2
24 0.13
25 0.13
26 0.14
27 0.15
28 0.17
29 0.16
30 0.14
31 0.14
32 0.14
33 0.15
34 0.15
35 0.16
36 0.14
37 0.2
38 0.2
39 0.25
40 0.29
41 0.3
42 0.36
43 0.43
44 0.51
45 0.53
46 0.54
47 0.58
48 0.61
49 0.63
50 0.61
51 0.57
52 0.56
53 0.53
54 0.57
55 0.49
56 0.47
57 0.43
58 0.4
59 0.43
60 0.41
61 0.43
62 0.45
63 0.49
64 0.48
65 0.49
66 0.53
67 0.54
68 0.5
69 0.44
70 0.41
71 0.39
72 0.34
73 0.34
74 0.28
75 0.2
76 0.16
77 0.19
78 0.16
79 0.13
80 0.15
81 0.13
82 0.14
83 0.14
84 0.16
85 0.14
86 0.14
87 0.14
88 0.13
89 0.13
90 0.13
91 0.13
92 0.12
93 0.13
94 0.13
95 0.15
96 0.17
97 0.19
98 0.18
99 0.21
100 0.24
101 0.26
102 0.27
103 0.26
104 0.33
105 0.37
106 0.39
107 0.41
108 0.39
109 0.43
110 0.45
111 0.47
112 0.42
113 0.37
114 0.4
115 0.39
116 0.43
117 0.42
118 0.44
119 0.49
120 0.48
121 0.47
122 0.44
123 0.49
124 0.54
125 0.58
126 0.62
127 0.59
128 0.64
129 0.66
130 0.7
131 0.67
132 0.62
133 0.53
134 0.45
135 0.42
136 0.39
137 0.43
138 0.45
139 0.46
140 0.48
141 0.56
142 0.62
143 0.68
144 0.75
145 0.76
146 0.78