Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CUB8

Protein Details
Accession I1CUB8   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
54-76ASASDYPTRRRKGRRIERFPTMKHydrophilic
NLS Segment(s)
PositionSequence
62-71RRRKGRRIER
Subcellular Location(s) mito 17, mito_nucl 11.833, cyto_mito 9.833, nucl 5.5
Family & Domain DBs
Amino Acid Sequences MYNKGHYLVQGFKLLLLLVSKLSSSGSPTTFDFRGQSFKILLLNTGAPSILGAASASDYPTRRRKGRRIERFPTMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.17
3 0.13
4 0.1
5 0.07
6 0.07
7 0.07
8 0.07
9 0.08
10 0.07
11 0.09
12 0.11
13 0.11
14 0.13
15 0.14
16 0.18
17 0.18
18 0.18
19 0.17
20 0.15
21 0.19
22 0.18
23 0.18
24 0.15
25 0.15
26 0.16
27 0.14
28 0.14
29 0.1
30 0.11
31 0.09
32 0.09
33 0.08
34 0.06
35 0.06
36 0.06
37 0.04
38 0.04
39 0.03
40 0.03
41 0.04
42 0.05
43 0.06
44 0.08
45 0.1
46 0.17
47 0.26
48 0.33
49 0.41
50 0.5
51 0.59
52 0.68
53 0.78
54 0.82
55 0.84
56 0.85