Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1C8E3

Protein Details
Accession I1C8E3   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MSEQEKLEKRRARRQQRILASAEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR028143  Get2/sif1  
Pfam View protein in Pfam  
PF08690  GET2  
Amino Acid Sequences MSEQEKLEKRRARRQQRILASAESRLNKITGSQSGLRQSPTPSPSNSVSSLPEAPISNTLAEHYPPPHDPRRQKYEERPALSKSQQHRPVVQKMIEEEQARELSESGILGGKVTQLLLAAMLRRTNPQERMQQKTAGHPANKYWNLLHFVSMAWLGTCAVYYEWLAHGVGGVGSLAKRDRSYYDAIHFEYRPTGESTFMSIASELPEPLKSSAYFVQKYGDLRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.88
4 0.86
5 0.79
6 0.74
7 0.65
8 0.59
9 0.55
10 0.47
11 0.38
12 0.34
13 0.3
14 0.23
15 0.24
16 0.24
17 0.21
18 0.24
19 0.26
20 0.29
21 0.34
22 0.36
23 0.35
24 0.32
25 0.32
26 0.33
27 0.35
28 0.34
29 0.31
30 0.33
31 0.34
32 0.36
33 0.35
34 0.3
35 0.28
36 0.27
37 0.27
38 0.23
39 0.22
40 0.18
41 0.17
42 0.18
43 0.17
44 0.14
45 0.12
46 0.13
47 0.12
48 0.12
49 0.13
50 0.12
51 0.14
52 0.17
53 0.23
54 0.29
55 0.37
56 0.45
57 0.51
58 0.59
59 0.63
60 0.68
61 0.72
62 0.75
63 0.75
64 0.71
65 0.66
66 0.6
67 0.59
68 0.54
69 0.51
70 0.45
71 0.46
72 0.49
73 0.48
74 0.51
75 0.52
76 0.55
77 0.54
78 0.5
79 0.42
80 0.36
81 0.37
82 0.34
83 0.29
84 0.23
85 0.2
86 0.19
87 0.17
88 0.15
89 0.13
90 0.09
91 0.08
92 0.07
93 0.05
94 0.05
95 0.05
96 0.05
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.03
103 0.03
104 0.03
105 0.04
106 0.05
107 0.05
108 0.06
109 0.07
110 0.08
111 0.12
112 0.16
113 0.2
114 0.25
115 0.33
116 0.37
117 0.45
118 0.46
119 0.48
120 0.45
121 0.46
122 0.49
123 0.45
124 0.42
125 0.35
126 0.36
127 0.4
128 0.4
129 0.36
130 0.29
131 0.27
132 0.3
133 0.29
134 0.26
135 0.17
136 0.16
137 0.15
138 0.14
139 0.11
140 0.06
141 0.06
142 0.06
143 0.05
144 0.05
145 0.05
146 0.05
147 0.06
148 0.06
149 0.07
150 0.07
151 0.08
152 0.08
153 0.07
154 0.07
155 0.06
156 0.06
157 0.05
158 0.04
159 0.04
160 0.04
161 0.06
162 0.07
163 0.09
164 0.1
165 0.12
166 0.14
167 0.18
168 0.23
169 0.25
170 0.29
171 0.31
172 0.34
173 0.36
174 0.34
175 0.31
176 0.3
177 0.27
178 0.23
179 0.22
180 0.2
181 0.18
182 0.18
183 0.21
184 0.19
185 0.19
186 0.17
187 0.14
188 0.14
189 0.14
190 0.15
191 0.11
192 0.11
193 0.12
194 0.14
195 0.15
196 0.18
197 0.16
198 0.19
199 0.25
200 0.32
201 0.32
202 0.31
203 0.33
204 0.34