FuNGI

I1C7C5

Protein Details

Accession

I1C7C5

Localization Confidence

Medium

Confidence Score

12.5

NoLS Segment(s)

Position	Sequence	Protein Nature
28-57	VVTPKTEEKRSAKRRRSDMMRKARRNTNTV	Hydrophilic

NLS Segment(s)

Position	Sequence
36-51	KRSAKRRRSDMMRKAR

Subcellular Location(s)

nucl 17.5, cyto_nucl 14, cyto 7.5

Family & Domain DBs

InterPro	View protein in InterPro IPR036188 FAD/NAD-bd_sf IPR020946 Flavin_mOase-like IPR002498 PInositol-4-P-5-kinase_core
Gene Ontology	GO:0005524 F:ATP binding GO:0050660 F:flavin adenine dinucleotide binding GO:0004499 F:N,N-dimethylaniline monooxygenase activity GO:0050661 F:NADP binding GO:0016307 F:phosphatidylinositol phosphate kinase activity
Pfam	View protein in Pfam PF00743 FMO-like PF01504 PIP5K
PROSITE	View protein in PROSITE PS51455 PIPK

Amino Acid Sequences

MDYSLLVGIHDMKKGNTECIRNQSLHIVVTPKTEEKRSAKRRRSDMMRKARRNTNTVSFESADLPLNPSEERKWCVFYADDGGFRSSDDQDKPSDKLYYVGVIDILTPYNIVKKVEHVWKSITQDKEGISAVHPIVYALDHPYVFKRPIKNVAVIGAGPHGLCSARHLKETGMNVKIFERNGYIGGLWKYSDTAPPKPKIPTSRVTLDESSLNEVPADGSKYQRTFEITPELTFALLKKCPPSACYRDLVTNIPSTVFAFPDFPMPEETPVFPKHQDMLAYFESYAETFGLLPLIELNTSVDRVTKIGDEWELVLSKYDIYPSGFVRETRWRERFDAVVAASGLHQDPYVPDIKDLIAYNKMWPTKVAHSKQFRRPEDFKDKNVLIVGVGISGVDIARSLDGFAKSIVMACKDSFTSPFQIINIIRSKIPKDIVIKPQVISFSNDNGQVDGTITFQDGTFIKDVDQVFFCTGYTNSLGYLDGLIIRENEYQSTSQPPFADVPKTLPLTMTHRQ

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.28
2	0.36
3	0.37
4	0.41
5	0.45
6	0.52
7	0.57
8	0.51
9	0.51
10	0.49
11	0.44
12	0.39
13	0.35
14	0.3
15	0.26
16	0.29
17	0.31
18	0.3
19	0.32
20	0.34
21	0.4
22	0.46
23	0.56
24	0.63
25	0.7
26	0.74
27	0.79
28	0.84
29	0.85
30	0.88
31	0.88
32	0.87
33	0.88
34	0.89
35	0.89
36	0.89
37	0.88
38	0.84
39	0.78
40	0.74
41	0.73
42	0.68
43	0.61
44	0.58
45	0.5
46	0.45
47	0.41
48	0.36
49	0.28
50	0.22
51	0.22
52	0.17
53	0.17
54	0.17
55	0.18
56	0.21
57	0.23
58	0.27
59	0.27
60	0.3
61	0.29
62	0.31
63	0.29
64	0.27
65	0.29
66	0.28
67	0.27
68	0.25
69	0.25
70	0.22
71	0.22
72	0.22
73	0.17
74	0.21
75	0.21
76	0.22
77	0.26
78	0.29
79	0.3
80	0.31
81	0.31
82	0.25
83	0.24
84	0.24
85	0.22
86	0.19
87	0.17
88	0.14
89	0.12
90	0.12
91	0.11
92	0.1
93	0.07
94	0.07
95	0.07
96	0.11
97	0.12
98	0.14
99	0.14
100	0.17
101	0.24
102	0.33
103	0.36
104	0.34
105	0.36
106	0.4
107	0.45
108	0.49
109	0.44
110	0.37
111	0.37
112	0.35
113	0.33
114	0.28
115	0.23
116	0.17
117	0.19
118	0.17
119	0.15
120	0.14
121	0.11
122	0.11
123	0.1
124	0.1
125	0.09
126	0.1
127	0.1
128	0.11
129	0.13
130	0.17
131	0.2
132	0.25
133	0.27
134	0.31
135	0.39
136	0.42
137	0.43
138	0.4
139	0.38
140	0.34
141	0.29
142	0.24
143	0.16
144	0.13
145	0.1
146	0.09
147	0.07
148	0.06
149	0.06
150	0.1
151	0.17
152	0.18
153	0.2
154	0.21
155	0.21
156	0.26
157	0.32
158	0.34
159	0.29
160	0.28
161	0.28
162	0.3
163	0.31
164	0.26
165	0.22
166	0.17
167	0.14
168	0.14
169	0.14
170	0.12
171	0.13
172	0.13
173	0.13
174	0.11
175	0.11
176	0.11
177	0.11
178	0.17
179	0.17
180	0.24
181	0.31
182	0.33
183	0.36
184	0.38
185	0.43
186	0.44
187	0.45
188	0.43
189	0.41
190	0.44
191	0.44
192	0.45
193	0.4
194	0.35
195	0.32
196	0.27
197	0.26
198	0.21
199	0.17
200	0.13
201	0.12
202	0.11
203	0.1
204	0.12
205	0.08
206	0.1
207	0.13
208	0.14
209	0.15
210	0.15
211	0.19
212	0.18
213	0.19
214	0.25
215	0.22
216	0.21
217	0.22
218	0.21
219	0.17
220	0.16
221	0.14
222	0.1
223	0.11
224	0.11
225	0.12
226	0.14
227	0.14
228	0.16
229	0.23
230	0.26
231	0.28
232	0.29
233	0.29
234	0.29
235	0.3
236	0.3
237	0.24
238	0.19
239	0.16
240	0.14
241	0.13
242	0.12
243	0.1
244	0.09
245	0.07
246	0.08
247	0.08
248	0.11
249	0.11
250	0.11
251	0.14
252	0.14
253	0.15
254	0.15
255	0.15
256	0.14
257	0.16
258	0.17
259	0.15
260	0.15
261	0.15
262	0.16
263	0.16
264	0.14
265	0.17
266	0.17
267	0.17
268	0.16
269	0.14
270	0.13
271	0.12
272	0.12
273	0.06
274	0.05
275	0.04
276	0.04
277	0.05
278	0.04
279	0.04
280	0.04
281	0.04
282	0.04
283	0.04
284	0.05
285	0.05
286	0.06
287	0.06
288	0.07
289	0.07
290	0.07
291	0.08
292	0.07
293	0.07
294	0.08
295	0.09
296	0.08
297	0.09
298	0.1
299	0.09
300	0.09
301	0.09
302	0.08
303	0.08
304	0.07
305	0.07
306	0.07
307	0.08
308	0.1
309	0.1
310	0.14
311	0.14
312	0.15
313	0.19
314	0.27
315	0.32
316	0.39
317	0.43
318	0.43
319	0.44
320	0.46
321	0.43
322	0.36
323	0.33
324	0.24
325	0.21
326	0.18
327	0.15
328	0.13
329	0.13
330	0.11
331	0.07
332	0.07
333	0.05
334	0.06
335	0.08
336	0.12
337	0.11
338	0.12
339	0.12
340	0.13
341	0.15
342	0.16
343	0.16
344	0.15
345	0.15
346	0.18
347	0.22
348	0.23
349	0.21
350	0.22
351	0.24
352	0.29
353	0.39
354	0.42
355	0.46
356	0.55
357	0.63
358	0.71
359	0.77
360	0.72
361	0.71
362	0.7
363	0.71
364	0.72
365	0.69
366	0.64
367	0.62
368	0.57
369	0.5
370	0.46
371	0.37
372	0.25
373	0.21
374	0.16
375	0.08
376	0.08
377	0.06
378	0.05
379	0.04
380	0.04
381	0.03
382	0.03
383	0.03
384	0.04
385	0.04
386	0.05
387	0.09
388	0.1
389	0.1
390	0.1
391	0.11
392	0.11
393	0.13
394	0.14
395	0.13
396	0.14
397	0.14
398	0.16
399	0.16
400	0.18
401	0.18
402	0.19
403	0.21
404	0.21
405	0.22
406	0.2
407	0.25
408	0.24
409	0.28
410	0.3
411	0.27
412	0.28
413	0.3
414	0.32
415	0.31
416	0.33
417	0.32
418	0.33
419	0.4
420	0.47
421	0.51
422	0.51
423	0.46
424	0.47
425	0.44
426	0.4
427	0.36
428	0.29
429	0.27
430	0.27
431	0.29
432	0.27
433	0.24
434	0.23
435	0.19
436	0.17
437	0.13
438	0.11
439	0.09
440	0.09
441	0.09
442	0.08
443	0.11
444	0.1
445	0.13
446	0.14
447	0.13
448	0.13
449	0.18
450	0.19
451	0.2
452	0.21
453	0.2
454	0.2
455	0.2
456	0.19
457	0.16
458	0.16
459	0.16
460	0.16
461	0.14
462	0.13
463	0.14
464	0.14
465	0.12
466	0.13
467	0.1
468	0.09
469	0.1
470	0.1
471	0.1
472	0.13
473	0.16
474	0.16
475	0.17
476	0.18
477	0.19
478	0.2
479	0.27
480	0.27
481	0.28
482	0.27
483	0.29
484	0.3
485	0.33
486	0.35
487	0.29
488	0.31
489	0.34
490	0.37
491	0.34
492	0.31
493	0.32

I1C7C5

3D AlphaFold-predicted Structure Viewer