Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1CPU3

Protein Details
Accession I1CPU3    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
72-93NYLGSNKKKPTRKVNNVQSSVKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto 8, mito 4, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003892  CUE  
IPR015940  UBA  
IPR009060  UBA-like_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0043130  F:ubiquitin binding  
Pfam View protein in Pfam  
PF02845  CUE  
PROSITE View protein in PROSITE  
PS51140  CUE  
PS50030  UBA  
CDD cd14279  CUE  
Amino Acid Sequences MGLPPTYQMRLLGLPVTDKSYVYLPAVQLLLSNSFSSFFSCFCGFLIGSIYDNTTIIKQWRFPTAIRQFVANYLGSNKKKPTRKVNNVQSSVKEEDVQTMSVMFPDYSRHEIEKALRTAKSDLNRATDILLTSSASSSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.2
4 0.18
5 0.17
6 0.17
7 0.16
8 0.17
9 0.17
10 0.18
11 0.15
12 0.16
13 0.16
14 0.15
15 0.14
16 0.13
17 0.13
18 0.12
19 0.12
20 0.1
21 0.11
22 0.11
23 0.12
24 0.12
25 0.1
26 0.12
27 0.13
28 0.13
29 0.12
30 0.14
31 0.12
32 0.11
33 0.14
34 0.1
35 0.1
36 0.1
37 0.1
38 0.09
39 0.09
40 0.09
41 0.07
42 0.08
43 0.1
44 0.11
45 0.14
46 0.16
47 0.19
48 0.21
49 0.21
50 0.3
51 0.33
52 0.38
53 0.34
54 0.34
55 0.3
56 0.29
57 0.31
58 0.2
59 0.14
60 0.12
61 0.19
62 0.19
63 0.22
64 0.25
65 0.31
66 0.38
67 0.45
68 0.53
69 0.57
70 0.66
71 0.74
72 0.8
73 0.82
74 0.81
75 0.76
76 0.68
77 0.62
78 0.54
79 0.44
80 0.34
81 0.25
82 0.23
83 0.21
84 0.19
85 0.14
86 0.12
87 0.11
88 0.1
89 0.11
90 0.07
91 0.06
92 0.09
93 0.13
94 0.16
95 0.18
96 0.19
97 0.2
98 0.23
99 0.29
100 0.33
101 0.34
102 0.36
103 0.35
104 0.36
105 0.38
106 0.41
107 0.41
108 0.41
109 0.4
110 0.41
111 0.41
112 0.39
113 0.36
114 0.32
115 0.27
116 0.21
117 0.19
118 0.14
119 0.13