Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1C201

Protein Details
Accession I1C201    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
88-120LTSVLRKRRLKMNKHKHKKLRKRTRALRKRLGKBasic
NLS Segment(s)
PositionSequence
93-120RKRRLKMNKHKHKKLRKRTRALRKRLGK
Subcellular Location(s) mito 18, nucl 7.5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MLFTGRFVINTVQRAITPKRTVNLQRNVSTLPIISNTRPVQLFNYNIKETPSVASISEYVSHLRPFSAPSAPQPLPTPLTQVQEQFELTSVLRKRRLKMNKHKHKKLRKRTRALRKRLGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.33
3 0.36
4 0.37
5 0.37
6 0.38
7 0.45
8 0.53
9 0.57
10 0.62
11 0.6
12 0.56
13 0.55
14 0.54
15 0.47
16 0.39
17 0.29
18 0.2
19 0.17
20 0.17
21 0.15
22 0.2
23 0.2
24 0.22
25 0.22
26 0.22
27 0.22
28 0.24
29 0.28
30 0.27
31 0.32
32 0.3
33 0.3
34 0.3
35 0.27
36 0.24
37 0.2
38 0.16
39 0.11
40 0.1
41 0.11
42 0.1
43 0.09
44 0.09
45 0.09
46 0.09
47 0.09
48 0.09
49 0.09
50 0.09
51 0.08
52 0.09
53 0.11
54 0.12
55 0.12
56 0.14
57 0.21
58 0.21
59 0.22
60 0.22
61 0.22
62 0.22
63 0.22
64 0.25
65 0.21
66 0.24
67 0.24
68 0.24
69 0.23
70 0.22
71 0.22
72 0.17
73 0.15
74 0.13
75 0.12
76 0.17
77 0.19
78 0.24
79 0.32
80 0.36
81 0.39
82 0.48
83 0.58
84 0.62
85 0.7
86 0.75
87 0.78
88 0.86
89 0.93
90 0.93
91 0.95
92 0.95
93 0.95
94 0.95
95 0.95
96 0.95
97 0.95
98 0.96
99 0.95
100 0.95