Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1CKF5

Protein Details
Accession I1CKF5    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-32YRYTSNQKAIKTKSRKFRKLRNNLKRDEVIHydrophilic
206-228RPERFCRLKKSLSTNSKRKNISSHydrophilic
NLS Segment(s)
PositionSequence
13-23KTKSRKFRKLR
Subcellular Location(s) nucl 17, mito_nucl 12.5, mito 6, cyto 4
Family & Domain DBs
Amino Acid Sequences MIYRYTSNQKAIKTKSRKFRKLRNNLKRDEVIVAELFLPHFKPSTVNKDKFVEYLQERAKVIPVMKAYYLNEDRPAAEDQGAGDFLPFRKMKLSSFINQQQADKRLVKKLRERFGNDAILILGNWSAGNVKYHGPIRGVGMKRMLAKEGFQVYLLDEFRTSSLCPSCQNGELEMFKKVQNSRPYQREKHPIADRHGFLSLRANGERPERFCRLKKSLSTNSKRKNISSSSASTSRLTKRPNNPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.74
3 0.81
4 0.85
5 0.86
6 0.88
7 0.89
8 0.9
9 0.92
10 0.93
11 0.92
12 0.87
13 0.85
14 0.78
15 0.69
16 0.61
17 0.51
18 0.43
19 0.33
20 0.28
21 0.2
22 0.17
23 0.15
24 0.12
25 0.12
26 0.09
27 0.1
28 0.09
29 0.14
30 0.2
31 0.3
32 0.4
33 0.42
34 0.46
35 0.49
36 0.5
37 0.46
38 0.42
39 0.39
40 0.31
41 0.36
42 0.35
43 0.35
44 0.34
45 0.33
46 0.33
47 0.28
48 0.27
49 0.23
50 0.21
51 0.2
52 0.2
53 0.22
54 0.21
55 0.26
56 0.28
57 0.25
58 0.26
59 0.24
60 0.24
61 0.24
62 0.25
63 0.18
64 0.15
65 0.14
66 0.12
67 0.12
68 0.12
69 0.09
70 0.07
71 0.07
72 0.07
73 0.13
74 0.12
75 0.12
76 0.15
77 0.17
78 0.18
79 0.24
80 0.28
81 0.25
82 0.33
83 0.39
84 0.42
85 0.42
86 0.43
87 0.4
88 0.39
89 0.4
90 0.36
91 0.33
92 0.35
93 0.39
94 0.43
95 0.47
96 0.53
97 0.55
98 0.58
99 0.6
100 0.57
101 0.57
102 0.53
103 0.44
104 0.35
105 0.28
106 0.21
107 0.16
108 0.11
109 0.06
110 0.03
111 0.03
112 0.03
113 0.04
114 0.04
115 0.05
116 0.06
117 0.07
118 0.1
119 0.12
120 0.13
121 0.13
122 0.14
123 0.16
124 0.22
125 0.22
126 0.21
127 0.22
128 0.22
129 0.24
130 0.24
131 0.23
132 0.16
133 0.16
134 0.18
135 0.18
136 0.16
137 0.14
138 0.14
139 0.13
140 0.16
141 0.16
142 0.12
143 0.1
144 0.1
145 0.1
146 0.11
147 0.1
148 0.1
149 0.12
150 0.13
151 0.14
152 0.17
153 0.19
154 0.21
155 0.22
156 0.2
157 0.21
158 0.23
159 0.23
160 0.22
161 0.21
162 0.19
163 0.23
164 0.25
165 0.29
166 0.35
167 0.42
168 0.48
169 0.57
170 0.64
171 0.66
172 0.71
173 0.74
174 0.7
175 0.71
176 0.71
177 0.68
178 0.66
179 0.68
180 0.6
181 0.53
182 0.52
183 0.42
184 0.34
185 0.36
186 0.32
187 0.28
188 0.28
189 0.27
190 0.26
191 0.33
192 0.37
193 0.34
194 0.38
195 0.41
196 0.47
197 0.52
198 0.58
199 0.59
200 0.62
201 0.65
202 0.68
203 0.72
204 0.76
205 0.8
206 0.81
207 0.83
208 0.84
209 0.8
210 0.74
211 0.71
212 0.66
213 0.63
214 0.58
215 0.54
216 0.52
217 0.52
218 0.51
219 0.46
220 0.47
221 0.47
222 0.47
223 0.5
224 0.52