Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BZ67

Protein Details
Accession I1BZ67    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
57-90SLKTDIIKKRNRNQTKRKTTRRKCQYQQDDETTCHydrophilic
NLS Segment(s)
PositionSequence
64-77KKRNRNQTKRKTTR
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR039355  Transcription_factor_GATA  
IPR000679  Znf_GATA  
IPR013088  Znf_NHR/GATA  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
GO:0008270  F:zinc ion binding  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00320  GATA  
PROSITE View protein in PROSITE  
PS00344  GATA_ZN_FINGER_1  
PS50114  GATA_ZN_FINGER_2  
CDD cd00202  ZnF_GATA  
Amino Acid Sequences MKTFIPLKKRYLLINSTRCFNCRTGNTPLWRRNPQGQPLCNACGLFYKLHGTVRPLSLKTDIIKKRNRNQTKRKTTRRKCQYQQDDETTCSELDEEEYEMKTITKDYTLSNDFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.56
3 0.56
4 0.55
5 0.52
6 0.48
7 0.42
8 0.4
9 0.35
10 0.38
11 0.4
12 0.46
13 0.52
14 0.58
15 0.64
16 0.64
17 0.65
18 0.64
19 0.65
20 0.65
21 0.66
22 0.65
23 0.59
24 0.56
25 0.55
26 0.52
27 0.44
28 0.36
29 0.27
30 0.21
31 0.21
32 0.16
33 0.13
34 0.14
35 0.14
36 0.16
37 0.16
38 0.16
39 0.16
40 0.19
41 0.21
42 0.19
43 0.19
44 0.19
45 0.2
46 0.19
47 0.26
48 0.28
49 0.33
50 0.4
51 0.47
52 0.54
53 0.64
54 0.73
55 0.74
56 0.8
57 0.84
58 0.87
59 0.9
60 0.92
61 0.93
62 0.93
63 0.93
64 0.93
65 0.92
66 0.9
67 0.9
68 0.89
69 0.87
70 0.85
71 0.81
72 0.74
73 0.65
74 0.58
75 0.48
76 0.38
77 0.28
78 0.21
79 0.13
80 0.12
81 0.11
82 0.11
83 0.11
84 0.12
85 0.12
86 0.12
87 0.12
88 0.11
89 0.12
90 0.11
91 0.11
92 0.12
93 0.14
94 0.22