Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BIA9

Protein Details
Accession I1BIA9    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
105-128KGPAPEDRSRRDRRRDRSASPSRRBasic
NLS Segment(s)
PositionSequence
112-128RSRRDRRRDRSASPSRR
Subcellular Location(s) cyto 14, cyto_nucl 10.5, nucl 5, cysk 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR008111  RNA-bd_8  
IPR000504  RRM_dom  
IPR033744  RRM_RBM8  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0003729  F:mRNA binding  
GO:0006396  P:RNA processing  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd12324  RRM_RBM8  
Amino Acid Sequences MSILKRLGRGGVMDEALEPVRSVEGWILIIQGLHEETDEDSLYERFREFGDVKTVHLNLDRQTGYVKGYAFIEYESRKEAEAAVEQANGTRYLGETIKVDYAFVKGPAPEDRSRRDRRRDRSASPSRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.16
4 0.15
5 0.11
6 0.08
7 0.08
8 0.08
9 0.08
10 0.07
11 0.07
12 0.08
13 0.08
14 0.08
15 0.07
16 0.07
17 0.07
18 0.07
19 0.06
20 0.05
21 0.05
22 0.05
23 0.06
24 0.07
25 0.07
26 0.07
27 0.08
28 0.08
29 0.09
30 0.09
31 0.09
32 0.08
33 0.08
34 0.13
35 0.12
36 0.14
37 0.21
38 0.2
39 0.21
40 0.24
41 0.24
42 0.2
43 0.2
44 0.2
45 0.13
46 0.18
47 0.17
48 0.14
49 0.14
50 0.14
51 0.13
52 0.14
53 0.13
54 0.09
55 0.1
56 0.1
57 0.09
58 0.09
59 0.12
60 0.1
61 0.11
62 0.12
63 0.12
64 0.12
65 0.12
66 0.12
67 0.11
68 0.11
69 0.13
70 0.12
71 0.12
72 0.11
73 0.12
74 0.13
75 0.11
76 0.09
77 0.07
78 0.07
79 0.09
80 0.1
81 0.1
82 0.1
83 0.11
84 0.14
85 0.14
86 0.14
87 0.12
88 0.13
89 0.14
90 0.14
91 0.14
92 0.11
93 0.14
94 0.19
95 0.25
96 0.29
97 0.33
98 0.41
99 0.49
100 0.59
101 0.66
102 0.72
103 0.76
104 0.8
105 0.85
106 0.86
107 0.84
108 0.85