Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1CUQ6

Protein Details
Accession I1CUQ6    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
108-128VSFVRPKKPLINERNRKKRLQHydrophilic
NLS Segment(s)
PositionSequence
114-126KKPLINERNRKKR
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR036397  RNaseH_sf  
IPR002492  Transposase_Tc1-like  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0015074  P:DNA integration  
GO:0006313  P:DNA transposition  
Pfam View protein in Pfam  
PF01498  HTH_Tnp_Tc3_2  
Amino Acid Sequences MQPLTEDRKNTIEFYLRQGFSYHKIAKLVKVSSSTVHKIRLELGLPARIDKGGRPKALTKREQQHLVRAVTVDGLENAVQAQQSLEQNLGKSVSVNTVRRALRDAGLVSFVRPKKPLINERNRKKRLQWARQHIDWTVTIWMNVIWSDETKVNRFGSDGKSYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.44
3 0.39
4 0.37
5 0.37
6 0.36
7 0.33
8 0.41
9 0.37
10 0.3
11 0.35
12 0.36
13 0.4
14 0.43
15 0.4
16 0.34
17 0.34
18 0.33
19 0.31
20 0.36
21 0.36
22 0.32
23 0.36
24 0.34
25 0.31
26 0.32
27 0.31
28 0.26
29 0.25
30 0.24
31 0.23
32 0.22
33 0.22
34 0.21
35 0.18
36 0.18
37 0.17
38 0.25
39 0.27
40 0.28
41 0.3
42 0.37
43 0.45
44 0.54
45 0.56
46 0.54
47 0.56
48 0.6
49 0.66
50 0.6
51 0.59
52 0.56
53 0.51
54 0.43
55 0.35
56 0.29
57 0.21
58 0.2
59 0.12
60 0.06
61 0.06
62 0.05
63 0.05
64 0.05
65 0.04
66 0.04
67 0.04
68 0.04
69 0.05
70 0.06
71 0.06
72 0.07
73 0.08
74 0.08
75 0.09
76 0.09
77 0.07
78 0.07
79 0.07
80 0.11
81 0.16
82 0.17
83 0.18
84 0.25
85 0.25
86 0.26
87 0.28
88 0.25
89 0.21
90 0.22
91 0.21
92 0.14
93 0.17
94 0.16
95 0.14
96 0.2
97 0.2
98 0.2
99 0.21
100 0.22
101 0.26
102 0.34
103 0.44
104 0.48
105 0.58
106 0.66
107 0.76
108 0.85
109 0.84
110 0.8
111 0.75
112 0.75
113 0.75
114 0.75
115 0.75
116 0.75
117 0.78
118 0.77
119 0.74
120 0.65
121 0.57
122 0.46
123 0.38
124 0.31
125 0.23
126 0.19
127 0.16
128 0.15
129 0.13
130 0.12
131 0.12
132 0.09
133 0.1
134 0.12
135 0.16
136 0.2
137 0.22
138 0.27
139 0.27
140 0.26
141 0.26
142 0.28
143 0.31