Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CDI8

Protein Details
Accession I1CDI8    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
91-116ALTPFEKSKKTLRQQKKEAHFPLRKYHydrophilic
NLS Segment(s)
PositionSequence
82-111VKKTRAMRRALTPFEKSKKTLRQQKKEAHF
Subcellular Location(s) nucl 21, mito_nucl 13.333, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MAAIKAHELRNKNKAELLKVLDEQKQALANLRVQKVAGGKSQEVGEARKNVARVLTVINQTQREQLALFYHKKKYVPLDLRVKKTRAMRRALTPFEKSKKTLRQQKKEAHFPLRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.48
3 0.48
4 0.46
5 0.41
6 0.4
7 0.42
8 0.41
9 0.37
10 0.33
11 0.29
12 0.26
13 0.22
14 0.24
15 0.22
16 0.23
17 0.28
18 0.29
19 0.28
20 0.25
21 0.27
22 0.25
23 0.25
24 0.24
25 0.2
26 0.19
27 0.2
28 0.2
29 0.2
30 0.18
31 0.18
32 0.18
33 0.17
34 0.18
35 0.19
36 0.19
37 0.17
38 0.16
39 0.14
40 0.12
41 0.13
42 0.15
43 0.15
44 0.17
45 0.19
46 0.2
47 0.2
48 0.2
49 0.17
50 0.14
51 0.12
52 0.11
53 0.12
54 0.15
55 0.2
56 0.22
57 0.26
58 0.28
59 0.29
60 0.31
61 0.32
62 0.38
63 0.39
64 0.44
65 0.51
66 0.55
67 0.63
68 0.66
69 0.62
70 0.58
71 0.6
72 0.61
73 0.57
74 0.58
75 0.54
76 0.57
77 0.64
78 0.66
79 0.62
80 0.59
81 0.6
82 0.6
83 0.6
84 0.54
85 0.55
86 0.58
87 0.63
88 0.69
89 0.71
90 0.75
91 0.81
92 0.88
93 0.88
94 0.88
95 0.86
96 0.86
97 0.83
98 0.76
99 0.76
100 0.75