Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1C0P7

Protein Details
Accession I1C0P7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
45-67WNRLDAKIKEDKKKRPSTGQINSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, cyto_mito 11.666, cyto 6.5, cyto_nucl 5.333, extr 3
Family & Domain DBs
Amino Acid Sequences MAKNSSFGESSKSTGMHAAFGTSAGDFGVVHVVHFKEFSIFLVSWNRLDAKIKEDKKKRPSTGQINS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.18
4 0.16
5 0.14
6 0.12
7 0.12
8 0.11
9 0.07
10 0.07
11 0.05
12 0.05
13 0.04
14 0.04
15 0.07
16 0.06
17 0.06
18 0.08
19 0.08
20 0.08
21 0.08
22 0.08
23 0.06
24 0.06
25 0.07
26 0.09
27 0.09
28 0.11
29 0.16
30 0.17
31 0.17
32 0.18
33 0.18
34 0.16
35 0.2
36 0.2
37 0.2
38 0.29
39 0.37
40 0.46
41 0.54
42 0.63
43 0.69
44 0.79
45 0.8
46 0.81
47 0.83