Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BQE8

Protein Details
Accession I1BQE8    Localization Confidence High Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
115-136MKKAKKLEAKKQKELSRKREEKBasic
171-191GVPPRCRRKVWKLKIGNRLNIHydrophilic
NLS Segment(s)
PositionSequence
116-139KKAKKLEAKKQKELSRKREEKDKK
Subcellular Location(s) nucl 23, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR035969  Rab-GAP_TBC_sf  
Amino Acid Sequences MPRRASPTENNNMTITSSDISGPFYSISDVLDDSSNTNTTAATVAAVAAAAAVASTGAKEDTSRKNRGARRNVNEMDVVVTSGGTSMGIKNKSTMLPPKDPQEEKKHLQEYQAMMKKAKKLEAKKQKELSRKREEKDKKTSQAIYLWETDIIPKWNQRIQDKKTVSLWDQGVPPRCRRKVWKLKIGNRLNITKETFIDCLKRAPLTSARKPKRTKQIAPTLNSYVGTGNLSLYKQRKRTSSLDVLREKKEDINTYPSDVEESRYESSEEEDEDDSESGGRPAMELDFQFENEEDDTTHDYDEGDDENDGDNDDDDDEDDDTDNLYLDDDDIESEEDQDKLVNNPAAISFLNKAIDEDILRTLPSLCVFQVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.28
3 0.18
4 0.15
5 0.14
6 0.13
7 0.16
8 0.15
9 0.15
10 0.13
11 0.13
12 0.13
13 0.12
14 0.12
15 0.11
16 0.11
17 0.11
18 0.12
19 0.12
20 0.12
21 0.14
22 0.14
23 0.13
24 0.13
25 0.12
26 0.11
27 0.11
28 0.1
29 0.08
30 0.07
31 0.06
32 0.06
33 0.06
34 0.05
35 0.04
36 0.03
37 0.03
38 0.02
39 0.02
40 0.02
41 0.02
42 0.03
43 0.03
44 0.04
45 0.04
46 0.06
47 0.13
48 0.24
49 0.32
50 0.37
51 0.42
52 0.51
53 0.59
54 0.68
55 0.72
56 0.72
57 0.72
58 0.76
59 0.73
60 0.67
61 0.59
62 0.49
63 0.4
64 0.3
65 0.23
66 0.13
67 0.1
68 0.08
69 0.07
70 0.06
71 0.04
72 0.05
73 0.07
74 0.13
75 0.15
76 0.15
77 0.16
78 0.19
79 0.2
80 0.25
81 0.31
82 0.32
83 0.38
84 0.41
85 0.46
86 0.52
87 0.54
88 0.56
89 0.57
90 0.58
91 0.55
92 0.61
93 0.59
94 0.53
95 0.52
96 0.51
97 0.44
98 0.46
99 0.48
100 0.41
101 0.39
102 0.41
103 0.44
104 0.41
105 0.45
106 0.43
107 0.44
108 0.53
109 0.62
110 0.67
111 0.71
112 0.76
113 0.77
114 0.79
115 0.81
116 0.8
117 0.8
118 0.8
119 0.73
120 0.76
121 0.78
122 0.77
123 0.77
124 0.77
125 0.71
126 0.7
127 0.69
128 0.61
129 0.55
130 0.49
131 0.41
132 0.33
133 0.27
134 0.21
135 0.19
136 0.17
137 0.14
138 0.14
139 0.13
140 0.13
141 0.16
142 0.18
143 0.23
144 0.29
145 0.36
146 0.39
147 0.47
148 0.47
149 0.46
150 0.47
151 0.46
152 0.41
153 0.37
154 0.33
155 0.25
156 0.27
157 0.28
158 0.33
159 0.33
160 0.38
161 0.42
162 0.43
163 0.44
164 0.49
165 0.56
166 0.59
167 0.65
168 0.69
169 0.7
170 0.76
171 0.83
172 0.81
173 0.75
174 0.68
175 0.62
176 0.54
177 0.47
178 0.4
179 0.31
180 0.26
181 0.23
182 0.2
183 0.18
184 0.18
185 0.15
186 0.16
187 0.16
188 0.15
189 0.13
190 0.15
191 0.23
192 0.28
193 0.36
194 0.45
195 0.51
196 0.59
197 0.64
198 0.69
199 0.71
200 0.73
201 0.71
202 0.7
203 0.74
204 0.72
205 0.71
206 0.67
207 0.58
208 0.5
209 0.43
210 0.34
211 0.23
212 0.17
213 0.14
214 0.1
215 0.08
216 0.08
217 0.08
218 0.13
219 0.18
220 0.24
221 0.3
222 0.34
223 0.37
224 0.42
225 0.46
226 0.49
227 0.54
228 0.54
229 0.57
230 0.61
231 0.62
232 0.58
233 0.55
234 0.48
235 0.42
236 0.39
237 0.34
238 0.3
239 0.32
240 0.31
241 0.32
242 0.31
243 0.27
244 0.26
245 0.22
246 0.21
247 0.15
248 0.18
249 0.17
250 0.17
251 0.18
252 0.15
253 0.17
254 0.16
255 0.15
256 0.14
257 0.13
258 0.13
259 0.14
260 0.13
261 0.11
262 0.1
263 0.1
264 0.08
265 0.08
266 0.07
267 0.06
268 0.06
269 0.07
270 0.09
271 0.08
272 0.12
273 0.12
274 0.13
275 0.14
276 0.13
277 0.14
278 0.13
279 0.13
280 0.1
281 0.11
282 0.14
283 0.14
284 0.14
285 0.12
286 0.12
287 0.12
288 0.13
289 0.11
290 0.09
291 0.08
292 0.09
293 0.1
294 0.1
295 0.1
296 0.09
297 0.08
298 0.08
299 0.08
300 0.08
301 0.07
302 0.08
303 0.08
304 0.09
305 0.09
306 0.08
307 0.08
308 0.08
309 0.08
310 0.07
311 0.07
312 0.06
313 0.06
314 0.07
315 0.06
316 0.07
317 0.07
318 0.09
319 0.09
320 0.11
321 0.11
322 0.11
323 0.11
324 0.12
325 0.12
326 0.12
327 0.19
328 0.19
329 0.17
330 0.19
331 0.19
332 0.2
333 0.19
334 0.2
335 0.16
336 0.17
337 0.19
338 0.18
339 0.18
340 0.17
341 0.19
342 0.17
343 0.17
344 0.18
345 0.17
346 0.17
347 0.16
348 0.16
349 0.16
350 0.17
351 0.17