Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1C5R7

Protein Details
Accession I1C5R7   
Localization Confidence Low
Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
97-128HKGYMKCQSQSSRHKQHKNKSAYLRKKCLMKPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 4.5, cyto_nucl 3.5, nucl 1.5
Family & Domain DBs
Amino Acid Sequences MVPSRPLSTETLGPIPQLAQGVMILITLPKLKLPIWVMLAGQTATSLKIPRHDNTILLKFLNCSLEITYLILKEEVDTAEMTVIRKDGKYSSEFFNHKGYMKCQSQSSRHKQHKNKSAYLRKKCLMKPGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.2
3 0.18
4 0.16
5 0.12
6 0.08
7 0.08
8 0.08
9 0.07
10 0.07
11 0.05
12 0.04
13 0.05
14 0.06
15 0.06
16 0.06
17 0.08
18 0.08
19 0.13
20 0.15
21 0.18
22 0.19
23 0.2
24 0.19
25 0.19
26 0.2
27 0.15
28 0.12
29 0.09
30 0.07
31 0.07
32 0.08
33 0.09
34 0.09
35 0.15
36 0.18
37 0.19
38 0.25
39 0.25
40 0.26
41 0.3
42 0.33
43 0.28
44 0.25
45 0.24
46 0.18
47 0.19
48 0.17
49 0.12
50 0.09
51 0.08
52 0.09
53 0.09
54 0.09
55 0.09
56 0.08
57 0.08
58 0.07
59 0.06
60 0.06
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.07
68 0.07
69 0.07
70 0.08
71 0.08
72 0.08
73 0.09
74 0.1
75 0.13
76 0.15
77 0.18
78 0.21
79 0.28
80 0.3
81 0.31
82 0.34
83 0.33
84 0.34
85 0.34
86 0.33
87 0.34
88 0.36
89 0.37
90 0.38
91 0.43
92 0.49
93 0.57
94 0.64
95 0.67
96 0.73
97 0.81
98 0.84
99 0.87
100 0.88
101 0.86
102 0.85
103 0.85
104 0.86
105 0.87
106 0.88
107 0.86
108 0.82
109 0.82
110 0.77