Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1CF89

Protein Details
Accession I1CF89    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
39-64ISQCENCREKRKTKKVHQKCECLMQKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001083  Cu_fist_DNA-bd_dom  
IPR036395  Cu_fist_DNA-bd_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0005507  F:copper ion binding  
GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00649  Copper-fist  
PROSITE View protein in PROSITE  
PS50073  COPPER_FIST_2  
Amino Acid Sequences MIIINNIKYACEIFQGHRSSRCDHKERLLKVVRKKGRPISQCENCREKRKTKKVHQKCECLMQKKSLKDKNSSFASSRYVMSIEALLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.3
3 0.32
4 0.37
5 0.4
6 0.4
7 0.46
8 0.51
9 0.5
10 0.49
11 0.55
12 0.57
13 0.56
14 0.62
15 0.61
16 0.6
17 0.62
18 0.69
19 0.67
20 0.64
21 0.69
22 0.68
23 0.68
24 0.67
25 0.66
26 0.66
27 0.67
28 0.68
29 0.66
30 0.66
31 0.61
32 0.65
33 0.62
34 0.62
35 0.64
36 0.68
37 0.73
38 0.76
39 0.83
40 0.85
41 0.91
42 0.9
43 0.87
44 0.8
45 0.8
46 0.77
47 0.73
48 0.65
49 0.63
50 0.61
51 0.59
52 0.67
53 0.64
54 0.6
55 0.62
56 0.64
57 0.63
58 0.62
59 0.59
60 0.51
61 0.46
62 0.46
63 0.4
64 0.35
65 0.29
66 0.24
67 0.2
68 0.19