Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1C1E3

Protein Details
Accession I1C1E3    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
99-124ALTPFEKSKKTLRQQKKEAHFPLRKYHydrophilic
NLS Segment(s)
PositionSequence
90-119VKKTRAMRRALTPFEKSKKTLRQQKKEAHF
Subcellular Location(s) nucl 19, cyto_nucl 12.333, mito_nucl 11.833, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSDKENTGTAIVKAFELRNKNKAELLKILDEQKQALANVRVQKVAGGKSQEIGEARKNVARVLTVINQTQREQLALFYHKKKYVPLDLRVKKTRAMRRALTPFEKSKKTLRQQKKEAHFPLRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.22
3 0.29
4 0.33
5 0.38
6 0.41
7 0.43
8 0.45
9 0.46
10 0.45
11 0.42
12 0.41
13 0.38
14 0.37
15 0.39
16 0.38
17 0.35
18 0.31
19 0.26
20 0.24
21 0.2
22 0.22
23 0.2
24 0.21
25 0.26
26 0.27
27 0.26
28 0.24
29 0.25
30 0.23
31 0.23
32 0.22
33 0.19
34 0.18
35 0.19
36 0.19
37 0.19
38 0.17
39 0.17
40 0.17
41 0.16
42 0.17
43 0.17
44 0.17
45 0.16
46 0.15
47 0.13
48 0.11
49 0.12
50 0.14
51 0.15
52 0.16
53 0.18
54 0.19
55 0.19
56 0.2
57 0.17
58 0.14
59 0.12
60 0.12
61 0.13
62 0.16
63 0.21
64 0.23
65 0.27
66 0.29
67 0.3
68 0.32
69 0.34
70 0.39
71 0.41
72 0.45
73 0.52
74 0.56
75 0.64
76 0.67
77 0.63
78 0.58
79 0.61
80 0.62
81 0.58
82 0.58
83 0.55
84 0.58
85 0.65
86 0.67
87 0.63
88 0.6
89 0.61
90 0.61
91 0.61
92 0.55
93 0.56
94 0.59
95 0.64
96 0.69
97 0.72
98 0.75
99 0.81
100 0.88
101 0.88
102 0.88
103 0.87
104 0.86
105 0.83
106 0.76
107 0.76
108 0.75