Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1C2C4

Protein Details
Accession I1C2C4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
82-104FDTQIKKKKPLLKKCHMEARLKWHydrophilic
NLS Segment(s)
PositionSequence
88-94KKKPLLK
Subcellular Location(s) mito 21.5, mito_nucl 12.333, cyto 3.5, cyto_nucl 3.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR002492  Transposase_Tc1-like  
Gene Ontology GO:0003677  F:DNA binding  
GO:0015074  P:DNA integration  
GO:0006313  P:DNA transposition  
Pfam View protein in Pfam  
PF01498  HTH_Tnp_Tc3_2  
Amino Acid Sequences MEHVPGVLMSTLSKHKGLYTPKRTRGHAGKKTTISSTTNNYLKRELVNGSLKTAKSVWPYLNSIGHKIGYFGTVKMLHSMGFDTQIKKKKPLLKKCHMEARLKWAKAHKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.25
4 0.35
5 0.42
6 0.49
7 0.57
8 0.66
9 0.71
10 0.72
11 0.74
12 0.74
13 0.74
14 0.72
15 0.7
16 0.68
17 0.66
18 0.65
19 0.59
20 0.51
21 0.44
22 0.38
23 0.35
24 0.35
25 0.36
26 0.36
27 0.36
28 0.34
29 0.32
30 0.29
31 0.26
32 0.2
33 0.21
34 0.24
35 0.23
36 0.24
37 0.26
38 0.25
39 0.24
40 0.23
41 0.2
42 0.17
43 0.19
44 0.18
45 0.17
46 0.19
47 0.2
48 0.25
49 0.23
50 0.22
51 0.21
52 0.2
53 0.18
54 0.16
55 0.15
56 0.12
57 0.12
58 0.1
59 0.12
60 0.13
61 0.13
62 0.14
63 0.14
64 0.12
65 0.12
66 0.13
67 0.1
68 0.13
69 0.15
70 0.17
71 0.24
72 0.33
73 0.35
74 0.39
75 0.46
76 0.51
77 0.6
78 0.67
79 0.71
80 0.73
81 0.79
82 0.82
83 0.86
84 0.83
85 0.8
86 0.73
87 0.74
88 0.73
89 0.65
90 0.62