Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CGX5

Protein Details
Accession I1CGX5   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAKKQKKKQPITSQNPTSKTKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR021867  Bmt2/SAMTOR  
Gene Ontology GO:0016740  F:transferase activity  
Pfam View protein in Pfam  
PF11968  Bmt2  
Amino Acid Sequences MAKKQKKKQPITSQNPTSKTKFKQSRVETARLIRRFHVLNKELAKCRADSETPKQREVEILKEMDSLGGLDWYQKASKLGQSKARGGDSSKWLIQTLKSHCKESIDSTTKPIKVLDVGAVAPDNYKQYSSWITAKPIDLNPQHPDIQKQDFLQMKPPAEDSKFDIVCLSLVVNFVGDPKDRGNLGHLLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.84
3 0.78
4 0.73
5 0.7
6 0.66
7 0.66
8 0.66
9 0.66
10 0.71
11 0.71
12 0.76
13 0.74
14 0.75
15 0.69
16 0.68
17 0.69
18 0.63
19 0.59
20 0.5
21 0.48
22 0.45
23 0.45
24 0.47
25 0.4
26 0.42
27 0.46
28 0.52
29 0.51
30 0.52
31 0.47
32 0.38
33 0.38
34 0.35
35 0.32
36 0.32
37 0.37
38 0.44
39 0.46
40 0.48
41 0.46
42 0.42
43 0.44
44 0.41
45 0.35
46 0.29
47 0.26
48 0.24
49 0.24
50 0.24
51 0.17
52 0.14
53 0.1
54 0.05
55 0.05
56 0.04
57 0.05
58 0.05
59 0.06
60 0.07
61 0.07
62 0.08
63 0.09
64 0.14
65 0.19
66 0.23
67 0.29
68 0.33
69 0.35
70 0.37
71 0.37
72 0.33
73 0.3
74 0.3
75 0.26
76 0.26
77 0.23
78 0.21
79 0.2
80 0.2
81 0.19
82 0.21
83 0.24
84 0.31
85 0.32
86 0.33
87 0.33
88 0.34
89 0.34
90 0.32
91 0.35
92 0.3
93 0.29
94 0.32
95 0.37
96 0.36
97 0.35
98 0.31
99 0.22
100 0.17
101 0.18
102 0.14
103 0.1
104 0.09
105 0.09
106 0.09
107 0.08
108 0.07
109 0.08
110 0.08
111 0.07
112 0.08
113 0.08
114 0.1
115 0.14
116 0.17
117 0.22
118 0.22
119 0.25
120 0.27
121 0.28
122 0.29
123 0.27
124 0.31
125 0.29
126 0.31
127 0.31
128 0.32
129 0.35
130 0.32
131 0.35
132 0.32
133 0.35
134 0.34
135 0.32
136 0.35
137 0.37
138 0.37
139 0.41
140 0.41
141 0.38
142 0.36
143 0.38
144 0.36
145 0.32
146 0.34
147 0.31
148 0.34
149 0.33
150 0.31
151 0.29
152 0.24
153 0.22
154 0.21
155 0.16
156 0.07
157 0.08
158 0.08
159 0.07
160 0.07
161 0.08
162 0.1
163 0.11
164 0.13
165 0.14
166 0.18
167 0.18
168 0.19
169 0.22