Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1C593

Protein Details
Accession I1C593    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MFYEIKDKRRKKKDNQSKSHFPRKSGBasic
NLS Segment(s)
PositionSequence
7-21DKRRKKKDNQSKSHF
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MFYEIKDKRRKKKDNQSKSHFPRKSGGEIGNYYDEDGRVKKKESDIWWVSGKTKRKQIDRSAVCEWTASSKGKIKDLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.93
3 0.92
4 0.92
5 0.91
6 0.91
7 0.82
8 0.74
9 0.69
10 0.63
11 0.59
12 0.53
13 0.46
14 0.39
15 0.37
16 0.37
17 0.32
18 0.28
19 0.23
20 0.18
21 0.15
22 0.12
23 0.13
24 0.14
25 0.14
26 0.15
27 0.17
28 0.19
29 0.25
30 0.26
31 0.34
32 0.33
33 0.35
34 0.36
35 0.35
36 0.37
37 0.37
38 0.42
39 0.39
40 0.45
41 0.48
42 0.53
43 0.6
44 0.66
45 0.71
46 0.68
47 0.69
48 0.66
49 0.61
50 0.53
51 0.45
52 0.35
53 0.3
54 0.28
55 0.24
56 0.24
57 0.29
58 0.32