Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1C423

Protein Details
Accession I1C423    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
22-44YQTMYGKKKKPFTQPKKNLQYTHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MLPHVVISLKNANNREQVERCYQTMYGKKKKPFTQPKKNLQYTHLLMSNSVHPKNYYQQLMMAKMSNCHLEKILIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.45
3 0.4
4 0.41
5 0.43
6 0.44
7 0.41
8 0.37
9 0.35
10 0.35
11 0.39
12 0.44
13 0.46
14 0.5
15 0.56
16 0.61
17 0.67
18 0.71
19 0.75
20 0.76
21 0.78
22 0.8
23 0.85
24 0.87
25 0.86
26 0.76
27 0.67
28 0.64
29 0.55
30 0.48
31 0.41
32 0.3
33 0.25
34 0.24
35 0.28
36 0.26
37 0.25
38 0.23
39 0.2
40 0.23
41 0.3
42 0.35
43 0.3
44 0.26
45 0.3
46 0.33
47 0.36
48 0.34
49 0.32
50 0.26
51 0.26
52 0.27
53 0.29
54 0.26
55 0.25
56 0.25