Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1C306

Protein Details
Accession I1C306    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MTEEVQKKRSRRTVKHERAVVGHydrophilic
NLS Segment(s)
PositionSequence
8-19KRSRRTVKHERA
27-68AIRAKRNQKPDARAAARQAAIAKSKEAKKSAAAAKKANPSAA
Subcellular Location(s) mito 14, nucl 12
Family & Domain DBs
Amino Acid Sequences MTEEVQKKRSRRTVKHERAVVGASWDAIRAKRNQKPDARAAARQAAIAKSKEAKKSAAAAKKANPSAASQSKVSKQQAKGFAPKAAATSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.88
3 0.84
4 0.75
5 0.67
6 0.6
7 0.49
8 0.4
9 0.3
10 0.21
11 0.15
12 0.14
13 0.12
14 0.11
15 0.14
16 0.18
17 0.27
18 0.32
19 0.4
20 0.47
21 0.52
22 0.56
23 0.6
24 0.63
25 0.58
26 0.55
27 0.5
28 0.46
29 0.4
30 0.35
31 0.29
32 0.21
33 0.2
34 0.18
35 0.17
36 0.18
37 0.22
38 0.25
39 0.26
40 0.25
41 0.24
42 0.31
43 0.37
44 0.39
45 0.39
46 0.39
47 0.42
48 0.48
49 0.48
50 0.43
51 0.36
52 0.32
53 0.36
54 0.38
55 0.35
56 0.29
57 0.33
58 0.36
59 0.43
60 0.47
61 0.47
62 0.47
63 0.53
64 0.6
65 0.61
66 0.65
67 0.61
68 0.58
69 0.52
70 0.48