Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BIN0

Protein Details
Accession I1BIN0    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
7-26SFGKKNAKSYKQKSTQQQLYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, mito_nucl 11.666, nucl 9, cyto_nucl 8.166, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036703  MOB_kinase_act_sf  
Amino Acid Sequences MNFLGLSFGKKNAKSYKQKSTQQQLYLSEPYVNHMLVQGNFKTIVELPKYVDMNEWLSFNSLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.63
3 0.68
4 0.71
5 0.77
6 0.79
7 0.8
8 0.78
9 0.72
10 0.68
11 0.6
12 0.55
13 0.49
14 0.4
15 0.31
16 0.24
17 0.21
18 0.18
19 0.15
20 0.11
21 0.1
22 0.12
23 0.11
24 0.14
25 0.12
26 0.12
27 0.13
28 0.13
29 0.13
30 0.13
31 0.16
32 0.15
33 0.16
34 0.18
35 0.23
36 0.24
37 0.23
38 0.23
39 0.21
40 0.23
41 0.23
42 0.21
43 0.16