Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BX89

Protein Details
Accession I1BX89    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
312-331ARAMSKVKVIRNRRRQQVGFHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 15, mito 9, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
IPR005135  Endo/exonuclease/phosphatase  
Gene Ontology GO:0003824  F:catalytic activity  
Pfam View protein in Pfam  
PF14529  Exo_endo_phos_2  
Amino Acid Sequences MAVVQFPVHTKYALGLRLGRSLRLICLYLPPSLSNDEVSSVLVSLPLTDDTIICGDLNARLGAITGDSVANARGSVLLRWCEEHGLSVLNSTLAPGVPTFLSYRGGQVKQSMIDYFLTNTTSALRSPRMQVYSDLSLGSDHKLLSLSFDYAVPDGYPSQPVLSSSSARRLWNLSRLKEPDVCSLYVASFQSLAVPLVDQFKALKSSPPSAAPPIDALNDSLNEAIYSALDKSVGSRSSRPSQWKPFWNAHLQELADVREHHYRRWRRAIGIDKALWWDRHQAAQVRFRAALKSAKRLSWRAFCDSLARGELARAMSKVKVIRNRRRQQVGFTHPDGPAAGASAMRQHLASVYSGDGLPSRRPDPLPSVSGMVPFDLDSQDPGMPSFTADSVGSLMRRLPLLSATSGRIPLLSGVKHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.29
4 0.37
5 0.37
6 0.35
7 0.33
8 0.31
9 0.31
10 0.29
11 0.28
12 0.21
13 0.27
14 0.28
15 0.26
16 0.27
17 0.25
18 0.24
19 0.26
20 0.26
21 0.2
22 0.19
23 0.19
24 0.17
25 0.17
26 0.14
27 0.12
28 0.11
29 0.1
30 0.09
31 0.07
32 0.08
33 0.08
34 0.08
35 0.08
36 0.08
37 0.09
38 0.1
39 0.11
40 0.09
41 0.09
42 0.09
43 0.1
44 0.12
45 0.1
46 0.09
47 0.08
48 0.08
49 0.08
50 0.08
51 0.07
52 0.06
53 0.06
54 0.06
55 0.07
56 0.07
57 0.07
58 0.06
59 0.06
60 0.08
61 0.09
62 0.11
63 0.15
64 0.17
65 0.18
66 0.2
67 0.21
68 0.21
69 0.2
70 0.19
71 0.16
72 0.15
73 0.14
74 0.13
75 0.12
76 0.1
77 0.1
78 0.09
79 0.08
80 0.06
81 0.07
82 0.06
83 0.07
84 0.07
85 0.08
86 0.09
87 0.1
88 0.12
89 0.12
90 0.17
91 0.22
92 0.23
93 0.23
94 0.24
95 0.26
96 0.24
97 0.26
98 0.21
99 0.17
100 0.17
101 0.16
102 0.15
103 0.14
104 0.13
105 0.12
106 0.11
107 0.12
108 0.11
109 0.12
110 0.13
111 0.15
112 0.16
113 0.2
114 0.25
115 0.26
116 0.26
117 0.27
118 0.29
119 0.29
120 0.27
121 0.23
122 0.18
123 0.17
124 0.16
125 0.15
126 0.12
127 0.09
128 0.09
129 0.09
130 0.09
131 0.11
132 0.11
133 0.11
134 0.1
135 0.11
136 0.11
137 0.1
138 0.11
139 0.08
140 0.07
141 0.08
142 0.08
143 0.08
144 0.08
145 0.08
146 0.08
147 0.09
148 0.11
149 0.12
150 0.14
151 0.14
152 0.21
153 0.24
154 0.24
155 0.25
156 0.26
157 0.26
158 0.33
159 0.38
160 0.34
161 0.37
162 0.4
163 0.42
164 0.42
165 0.42
166 0.39
167 0.35
168 0.33
169 0.27
170 0.24
171 0.21
172 0.19
173 0.16
174 0.1
175 0.08
176 0.07
177 0.07
178 0.07
179 0.07
180 0.05
181 0.05
182 0.05
183 0.08
184 0.08
185 0.07
186 0.07
187 0.08
188 0.11
189 0.11
190 0.14
191 0.14
192 0.17
193 0.18
194 0.2
195 0.21
196 0.2
197 0.21
198 0.17
199 0.16
200 0.14
201 0.13
202 0.11
203 0.11
204 0.09
205 0.09
206 0.09
207 0.08
208 0.06
209 0.06
210 0.05
211 0.05
212 0.04
213 0.04
214 0.04
215 0.04
216 0.04
217 0.04
218 0.06
219 0.09
220 0.11
221 0.13
222 0.16
223 0.21
224 0.27
225 0.32
226 0.38
227 0.42
228 0.5
229 0.55
230 0.59
231 0.6
232 0.59
233 0.59
234 0.59
235 0.52
236 0.45
237 0.41
238 0.34
239 0.3
240 0.26
241 0.22
242 0.16
243 0.15
244 0.16
245 0.21
246 0.22
247 0.24
248 0.32
249 0.39
250 0.45
251 0.55
252 0.55
253 0.51
254 0.58
255 0.64
256 0.6
257 0.59
258 0.52
259 0.43
260 0.43
261 0.43
262 0.35
263 0.28
264 0.27
265 0.22
266 0.24
267 0.27
268 0.31
269 0.34
270 0.41
271 0.42
272 0.39
273 0.39
274 0.37
275 0.35
276 0.3
277 0.33
278 0.28
279 0.34
280 0.35
281 0.37
282 0.42
283 0.46
284 0.49
285 0.49
286 0.51
287 0.48
288 0.46
289 0.43
290 0.42
291 0.38
292 0.34
293 0.27
294 0.23
295 0.17
296 0.16
297 0.18
298 0.15
299 0.15
300 0.13
301 0.13
302 0.13
303 0.17
304 0.22
305 0.26
306 0.33
307 0.43
308 0.53
309 0.63
310 0.71
311 0.77
312 0.82
313 0.78
314 0.77
315 0.77
316 0.75
317 0.71
318 0.66
319 0.61
320 0.51
321 0.49
322 0.41
323 0.31
324 0.22
325 0.15
326 0.12
327 0.08
328 0.08
329 0.11
330 0.11
331 0.11
332 0.11
333 0.1
334 0.11
335 0.12
336 0.13
337 0.1
338 0.1
339 0.11
340 0.11
341 0.11
342 0.12
343 0.14
344 0.17
345 0.2
346 0.21
347 0.25
348 0.26
349 0.31
350 0.35
351 0.39
352 0.38
353 0.35
354 0.37
355 0.33
356 0.34
357 0.3
358 0.23
359 0.17
360 0.15
361 0.14
362 0.12
363 0.12
364 0.11
365 0.13
366 0.13
367 0.13
368 0.13
369 0.13
370 0.12
371 0.12
372 0.13
373 0.11
374 0.12
375 0.12
376 0.12
377 0.12
378 0.14
379 0.14
380 0.13
381 0.14
382 0.14
383 0.15
384 0.14
385 0.14
386 0.15
387 0.18
388 0.21
389 0.22
390 0.24
391 0.26
392 0.27
393 0.26
394 0.22
395 0.2
396 0.2
397 0.23