Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3REP2

Protein Details
Accession E3REP2   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
42-79DQAPKPQPQKRRRVTRACDECRRKKIKCDGKQPCTHCTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG pte:PTT_04846  -  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MTSPTLTTTESLAADSARSGPHDVQPEDTSEFGEENSDPNDDQAPKPQPQKRRRVTRACDECRRKKIKCDGKQPCTHCTVYSYEWYMPNSLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.09
5 0.1
6 0.12
7 0.13
8 0.18
9 0.24
10 0.24
11 0.26
12 0.26
13 0.28
14 0.27
15 0.25
16 0.21
17 0.15
18 0.15
19 0.11
20 0.11
21 0.08
22 0.08
23 0.09
24 0.09
25 0.08
26 0.09
27 0.11
28 0.11
29 0.12
30 0.17
31 0.2
32 0.24
33 0.32
34 0.37
35 0.44
36 0.52
37 0.62
38 0.65
39 0.72
40 0.77
41 0.79
42 0.81
43 0.82
44 0.83
45 0.81
46 0.82
47 0.81
48 0.81
49 0.8
50 0.82
51 0.74
52 0.73
53 0.76
54 0.76
55 0.76
56 0.78
57 0.79
58 0.8
59 0.86
60 0.81
61 0.75
62 0.69
63 0.61
64 0.51
65 0.43
66 0.39
67 0.33
68 0.34
69 0.34
70 0.31
71 0.33
72 0.34