Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BRM6

Protein Details
Accession I1BRM6    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
121-148SKNFISCISQKKRRKWYRDKPSHTIEGWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, mito_nucl 13.833, nucl 11.5, cyto_nucl 7.166
Family & Domain DBs
Amino Acid Sequences MTKYLPYMLKKISNCKHESLRFRIHLVRTAANLFRIARISKWTINRIRREEKNIKACDHGSRQVVVSKITNAIIRLKFRQGPLRTVSDAQLFLRFLGYNISKLSVKRHCRKLDFESGTKESKNFISCISQKKRRKWYRDKPSHTIEGWKSIIFSNEKNMNAMSADSIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.6
3 0.64
4 0.65
5 0.68
6 0.66
7 0.68
8 0.62
9 0.62
10 0.62
11 0.56
12 0.54
13 0.5
14 0.45
15 0.38
16 0.39
17 0.36
18 0.3
19 0.3
20 0.24
21 0.22
22 0.22
23 0.21
24 0.18
25 0.21
26 0.25
27 0.28
28 0.33
29 0.4
30 0.46
31 0.53
32 0.6
33 0.63
34 0.67
35 0.67
36 0.72
37 0.72
38 0.71
39 0.73
40 0.68
41 0.61
42 0.56
43 0.53
44 0.49
45 0.45
46 0.41
47 0.33
48 0.3
49 0.29
50 0.28
51 0.27
52 0.23
53 0.19
54 0.15
55 0.14
56 0.14
57 0.14
58 0.12
59 0.17
60 0.18
61 0.2
62 0.21
63 0.23
64 0.25
65 0.26
66 0.34
67 0.3
68 0.32
69 0.32
70 0.34
71 0.32
72 0.3
73 0.29
74 0.22
75 0.21
76 0.17
77 0.16
78 0.12
79 0.11
80 0.11
81 0.09
82 0.08
83 0.11
84 0.11
85 0.11
86 0.11
87 0.13
88 0.14
89 0.14
90 0.21
91 0.26
92 0.35
93 0.43
94 0.52
95 0.57
96 0.6
97 0.66
98 0.66
99 0.68
100 0.64
101 0.58
102 0.56
103 0.52
104 0.5
105 0.45
106 0.38
107 0.29
108 0.27
109 0.26
110 0.2
111 0.18
112 0.23
113 0.28
114 0.38
115 0.45
116 0.52
117 0.59
118 0.68
119 0.77
120 0.8
121 0.86
122 0.87
123 0.89
124 0.9
125 0.93
126 0.92
127 0.88
128 0.85
129 0.81
130 0.71
131 0.69
132 0.6
133 0.56
134 0.49
135 0.41
136 0.35
137 0.29
138 0.33
139 0.27
140 0.26
141 0.28
142 0.32
143 0.33
144 0.33
145 0.32
146 0.28
147 0.26
148 0.25