Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1C3U6

Protein Details
Accession I1C3U6    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-37MPKKLNYKKHKKDKERNEHKRKKRKRQEYVPPVLNEEBasic
202-226TSEEIKKNVRREQRKYHPDKFMTRVHydrophilic
NLS Segment(s)
PositionSequence
4-26KLNYKKHKKDKERNEHKRKKRKR
115-156KAEKEKRRKEKAEARRKVREEEAERERVREAYREKEKAKRSR
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038753  NFKBIL1  
Gene Ontology GO:0007249  P:I-kappaB kinase/NF-kappaB signaling  
Amino Acid Sequences MPKKLNYKKHKKDKERNEHKRKKRKRQEYVPPVLNEEGWTPSDQAYKQDQDEWRERLFDAMMQDEGQDAYFSNYNNYTPSYTSNEMTDEEYRQYIVNGMYRKRHAAEIAAEEEWKAEKEKRRKEKAEARRKVREEEAERERVREAYREKEKAKRSRVAQEDYEIKWQQLDEAKVIKSEDIPWPIVNNDFSLNSVRSFMTKGTSEEIKKNVRREQRKYHPDKFMTRVMSRFEGTADEKECVLSRMNEISGWLNELWASV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.96
2 0.96
3 0.96
4 0.97
5 0.96
6 0.96
7 0.96
8 0.96
9 0.96
10 0.96
11 0.96
12 0.95
13 0.96
14 0.96
15 0.96
16 0.95
17 0.91
18 0.82
19 0.74
20 0.64
21 0.53
22 0.43
23 0.33
24 0.26
25 0.19
26 0.18
27 0.15
28 0.16
29 0.2
30 0.19
31 0.22
32 0.26
33 0.28
34 0.28
35 0.34
36 0.37
37 0.39
38 0.46
39 0.45
40 0.4
41 0.38
42 0.37
43 0.32
44 0.28
45 0.23
46 0.18
47 0.15
48 0.15
49 0.13
50 0.13
51 0.12
52 0.11
53 0.09
54 0.07
55 0.06
56 0.07
57 0.09
58 0.09
59 0.11
60 0.12
61 0.12
62 0.14
63 0.15
64 0.14
65 0.14
66 0.17
67 0.21
68 0.22
69 0.22
70 0.22
71 0.21
72 0.21
73 0.23
74 0.21
75 0.17
76 0.15
77 0.15
78 0.15
79 0.13
80 0.12
81 0.11
82 0.11
83 0.14
84 0.17
85 0.19
86 0.23
87 0.24
88 0.27
89 0.26
90 0.26
91 0.22
92 0.21
93 0.21
94 0.19
95 0.2
96 0.18
97 0.17
98 0.15
99 0.15
100 0.13
101 0.1
102 0.09
103 0.12
104 0.19
105 0.29
106 0.39
107 0.49
108 0.58
109 0.62
110 0.69
111 0.75
112 0.78
113 0.8
114 0.79
115 0.76
116 0.76
117 0.74
118 0.68
119 0.61
120 0.58
121 0.52
122 0.5
123 0.48
124 0.47
125 0.45
126 0.43
127 0.4
128 0.34
129 0.3
130 0.28
131 0.26
132 0.27
133 0.34
134 0.39
135 0.42
136 0.47
137 0.56
138 0.59
139 0.63
140 0.61
141 0.58
142 0.61
143 0.64
144 0.61
145 0.54
146 0.49
147 0.47
148 0.42
149 0.44
150 0.35
151 0.29
152 0.25
153 0.23
154 0.21
155 0.21
156 0.21
157 0.16
158 0.19
159 0.2
160 0.2
161 0.21
162 0.18
163 0.15
164 0.16
165 0.18
166 0.18
167 0.19
168 0.18
169 0.19
170 0.2
171 0.21
172 0.19
173 0.15
174 0.13
175 0.12
176 0.13
177 0.15
178 0.15
179 0.14
180 0.15
181 0.14
182 0.13
183 0.14
184 0.14
185 0.14
186 0.15
187 0.16
188 0.19
189 0.25
190 0.27
191 0.3
192 0.36
193 0.42
194 0.45
195 0.51
196 0.55
197 0.6
198 0.67
199 0.71
200 0.76
201 0.77
202 0.83
203 0.86
204 0.86
205 0.86
206 0.83
207 0.81
208 0.75
209 0.72
210 0.68
211 0.62
212 0.56
213 0.51
214 0.48
215 0.42
216 0.37
217 0.3
218 0.27
219 0.27
220 0.29
221 0.27
222 0.24
223 0.23
224 0.24
225 0.24
226 0.21
227 0.21
228 0.17
229 0.18
230 0.21
231 0.22
232 0.21
233 0.22
234 0.24
235 0.22
236 0.24
237 0.2
238 0.16