Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1CAE3

Protein Details
Accession I1CAE3    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
34-54NIGSRVPKRIKRRRFGREAEABasic
NLS Segment(s)
PositionSequence
40-48PKRIKRRRF
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MPNSILWKGTTRKKFSNGTIGSKSDTISATDLINIGSRVPKRIKRRRFGREAEAYSTGTVTRHYLSFQKATPDEMDKYLEIKEHYLVTDNAPIHSSIDIGKYIYSRVCRCAYLPHILSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.63
3 0.67
4 0.62
5 0.61
6 0.58
7 0.53
8 0.49
9 0.43
10 0.38
11 0.3
12 0.25
13 0.19
14 0.16
15 0.15
16 0.12
17 0.12
18 0.12
19 0.1
20 0.1
21 0.09
22 0.08
23 0.12
24 0.12
25 0.17
26 0.23
27 0.3
28 0.4
29 0.51
30 0.6
31 0.65
32 0.75
33 0.79
34 0.82
35 0.8
36 0.78
37 0.76
38 0.7
39 0.63
40 0.55
41 0.46
42 0.37
43 0.31
44 0.22
45 0.14
46 0.11
47 0.08
48 0.07
49 0.07
50 0.08
51 0.11
52 0.13
53 0.16
54 0.16
55 0.2
56 0.19
57 0.21
58 0.22
59 0.22
60 0.21
61 0.2
62 0.21
63 0.16
64 0.17
65 0.16
66 0.16
67 0.13
68 0.13
69 0.13
70 0.12
71 0.12
72 0.14
73 0.14
74 0.14
75 0.19
76 0.18
77 0.17
78 0.17
79 0.17
80 0.15
81 0.15
82 0.13
83 0.09
84 0.1
85 0.11
86 0.1
87 0.11
88 0.11
89 0.12
90 0.16
91 0.22
92 0.22
93 0.27
94 0.29
95 0.3
96 0.31
97 0.38
98 0.38
99 0.41