Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CU42

Protein Details
Accession I1CU42    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
62-83RSSRTRSGTRPASRRSTKKRRIBasic
NLS Segment(s)
PositionSequence
65-83RTRSGTRPASRRSTKKRRI
Subcellular Location(s) nucl 20.5, cyto_nucl 15, cyto 6.5
Family & Domain DBs
Amino Acid Sequences METNTHLAEQTNDTHPEENFDFELLPDLDSPHELEGGNSNEINIATSLSSAVSLLPPSPSLRSSRTRSGTRPASRRSTKKRRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.28
4 0.26
5 0.25
6 0.2
7 0.18
8 0.16
9 0.14
10 0.17
11 0.12
12 0.12
13 0.09
14 0.1
15 0.09
16 0.1
17 0.11
18 0.07
19 0.08
20 0.07
21 0.07
22 0.11
23 0.12
24 0.13
25 0.12
26 0.11
27 0.11
28 0.11
29 0.11
30 0.07
31 0.05
32 0.04
33 0.04
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.05
41 0.05
42 0.06
43 0.07
44 0.08
45 0.1
46 0.12
47 0.15
48 0.2
49 0.27
50 0.32
51 0.4
52 0.46
53 0.5
54 0.52
55 0.58
56 0.64
57 0.66
58 0.68
59 0.66
60 0.69
61 0.74
62 0.8
63 0.82