Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BLH3

Protein Details
Accession I1BLH3    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
110-134VINQLQQQKPYNRNHRPNNNPISQQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 13, cyto 7.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
Amino Acid Sequences MIEQQKVAANFLQVKDMNAQCKNFDCEVIVLQPDNEPTGTRDGDVVYKFLVADRTGSVVMTVWGTKGSEIKNGDILRLSGVKCKLKRVGQDTLPFVEKPNMSEKEYVKPVINQLQQQKPYNRNHRPNNNPISQQGRMNRIRYHQDLDNPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.33
4 0.36
5 0.36
6 0.37
7 0.33
8 0.36
9 0.4
10 0.33
11 0.31
12 0.25
13 0.22
14 0.22
15 0.22
16 0.19
17 0.14
18 0.14
19 0.14
20 0.13
21 0.13
22 0.11
23 0.1
24 0.11
25 0.15
26 0.14
27 0.14
28 0.14
29 0.13
30 0.17
31 0.17
32 0.15
33 0.11
34 0.11
35 0.11
36 0.11
37 0.12
38 0.08
39 0.09
40 0.09
41 0.1
42 0.1
43 0.1
44 0.09
45 0.07
46 0.07
47 0.07
48 0.06
49 0.05
50 0.05
51 0.05
52 0.06
53 0.08
54 0.09
55 0.13
56 0.14
57 0.15
58 0.2
59 0.2
60 0.19
61 0.17
62 0.16
63 0.13
64 0.14
65 0.13
66 0.12
67 0.17
68 0.22
69 0.23
70 0.27
71 0.32
72 0.34
73 0.4
74 0.41
75 0.44
76 0.43
77 0.47
78 0.45
79 0.41
80 0.39
81 0.33
82 0.29
83 0.27
84 0.22
85 0.19
86 0.24
87 0.25
88 0.25
89 0.3
90 0.31
91 0.33
92 0.36
93 0.36
94 0.3
95 0.28
96 0.31
97 0.34
98 0.36
99 0.35
100 0.4
101 0.46
102 0.51
103 0.56
104 0.59
105 0.59
106 0.66
107 0.71
108 0.74
109 0.76
110 0.8
111 0.84
112 0.85
113 0.87
114 0.86
115 0.82
116 0.75
117 0.7
118 0.67
119 0.59
120 0.57
121 0.53
122 0.53
123 0.53
124 0.55
125 0.54
126 0.54
127 0.59
128 0.57
129 0.56
130 0.53