Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BRC6

Protein Details
Accession I1BRC6    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MKLKLKRRKKAGLKWKYQKKNIYCLSHydrophilic
NLS Segment(s)
PositionSequence
4-17KLKRRKKAGLKWKY
Subcellular Location(s) nucl 21.5, mito_nucl 14.333, cyto_nucl 11.666
Family & Domain DBs
Amino Acid Sequences MKLKLKRRKKAGLKWKYQKKNIYCLSYFMSEHYISEEENNRDECSSEKKRETCVEITCHSKPKGYLTWFYSKECQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.91
4 0.89
5 0.88
6 0.82
7 0.81
8 0.77
9 0.73
10 0.63
11 0.56
12 0.51
13 0.44
14 0.38
15 0.29
16 0.26
17 0.19
18 0.18
19 0.17
20 0.14
21 0.11
22 0.14
23 0.17
24 0.15
25 0.17
26 0.18
27 0.16
28 0.16
29 0.16
30 0.15
31 0.19
32 0.25
33 0.29
34 0.34
35 0.36
36 0.41
37 0.45
38 0.48
39 0.44
40 0.42
41 0.41
42 0.38
43 0.43
44 0.42
45 0.45
46 0.41
47 0.39
48 0.36
49 0.38
50 0.43
51 0.41
52 0.44
53 0.43
54 0.52
55 0.52