Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BLA1

Protein Details
Accession I1BLA1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
75-98YGNTSKKSKWCGKKIKIKGPKGTVHydrophilic
NLS Segment(s)
PositionSequence
87-92KKIKIK
Subcellular Location(s) extr 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR036908  RlpA-like_sf  
CDD cd22191  DPBB_RlpA_EXP_N-like  
Amino Acid Sequences MPRLSLFAVAIFAAASLINAAPIKDVELEKRGGTSGTFTGTGTWFLPASEGGPQGACGPKENNNSMIVALNVAQYGNTSKKSKWCGKKIKIKGPKGTVTAKINDACPGCKKGDLDLTPAVFKKVIGDMNKGVGKITWSVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.04
5 0.06
6 0.06
7 0.06
8 0.07
9 0.07
10 0.09
11 0.11
12 0.12
13 0.14
14 0.17
15 0.18
16 0.17
17 0.18
18 0.17
19 0.15
20 0.14
21 0.13
22 0.11
23 0.12
24 0.12
25 0.11
26 0.12
27 0.12
28 0.14
29 0.11
30 0.11
31 0.09
32 0.08
33 0.09
34 0.08
35 0.08
36 0.08
37 0.08
38 0.08
39 0.07
40 0.08
41 0.09
42 0.11
43 0.11
44 0.11
45 0.12
46 0.19
47 0.23
48 0.24
49 0.24
50 0.23
51 0.23
52 0.21
53 0.19
54 0.13
55 0.09
56 0.08
57 0.06
58 0.05
59 0.05
60 0.04
61 0.04
62 0.06
63 0.08
64 0.11
65 0.13
66 0.14
67 0.2
68 0.28
69 0.37
70 0.44
71 0.53
72 0.6
73 0.68
74 0.77
75 0.81
76 0.84
77 0.85
78 0.84
79 0.82
80 0.77
81 0.73
82 0.67
83 0.62
84 0.57
85 0.51
86 0.46
87 0.41
88 0.36
89 0.32
90 0.32
91 0.28
92 0.25
93 0.25
94 0.26
95 0.24
96 0.25
97 0.25
98 0.25
99 0.33
100 0.31
101 0.32
102 0.33
103 0.33
104 0.33
105 0.33
106 0.31
107 0.22
108 0.21
109 0.18
110 0.18
111 0.23
112 0.23
113 0.28
114 0.28
115 0.35
116 0.37
117 0.34
118 0.3
119 0.25
120 0.24