Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CFL5

Protein Details
Accession I1CFL5    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
25-45GGGLKPKKSKQAKKAVTNRSFHydrophilic
NLS Segment(s)
PositionSequence
25-38GGGLKPKKSKQAKK
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MSKRDPIVEEKLTLSRSKSAFIKLGGGLKPKKSKQAKKAVTNRSFEEESKDIYSGSNTSQHSFVKRMASFMKPSRSSKPVEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.26
4 0.28
5 0.28
6 0.28
7 0.29
8 0.28
9 0.29
10 0.24
11 0.29
12 0.27
13 0.31
14 0.3
15 0.33
16 0.4
17 0.39
18 0.47
19 0.52
20 0.59
21 0.62
22 0.7
23 0.72
24 0.74
25 0.82
26 0.83
27 0.79
28 0.73
29 0.65
30 0.59
31 0.53
32 0.43
33 0.39
34 0.29
35 0.25
36 0.24
37 0.22
38 0.17
39 0.15
40 0.16
41 0.12
42 0.12
43 0.16
44 0.15
45 0.17
46 0.19
47 0.21
48 0.23
49 0.25
50 0.26
51 0.29
52 0.28
53 0.3
54 0.32
55 0.34
56 0.38
57 0.43
58 0.49
59 0.47
60 0.52
61 0.55
62 0.56