Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BWM6

Protein Details
Accession I1BWM6   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
48-76SSNYSIGIKKKQRKRAPKKFKSEEERREFHydrophilic
NLS Segment(s)
PositionSequence
56-75KKKQRKRAPKKFKSEEERRE
Subcellular Location(s) nucl 23, cyto_nucl 15.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
IPR002112  Leuzip_Jun  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
CDD cd14687  bZIP_ATF2  
Amino Acid Sequences MNEPNPFEQSFGTDTSAFEYIQHHRLGSDTSSYKSNVETVCSMDSNSSSNYSIGIKKKQRKRAPKKFKSEEERREFLERNRLAALKCRQRKKQWLSNLQERIEFLTQDNEQLELETNELRQEIINLKQLLLTHKDCPQYKQHPISY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.21
4 0.17
5 0.15
6 0.17
7 0.18
8 0.22
9 0.23
10 0.2
11 0.18
12 0.19
13 0.21
14 0.19
15 0.21
16 0.19
17 0.2
18 0.22
19 0.23
20 0.23
21 0.21
22 0.23
23 0.17
24 0.18
25 0.17
26 0.17
27 0.18
28 0.18
29 0.17
30 0.14
31 0.14
32 0.13
33 0.13
34 0.13
35 0.11
36 0.11
37 0.12
38 0.13
39 0.18
40 0.21
41 0.28
42 0.35
43 0.43
44 0.52
45 0.61
46 0.69
47 0.75
48 0.82
49 0.85
50 0.88
51 0.89
52 0.91
53 0.89
54 0.88
55 0.87
56 0.85
57 0.84
58 0.8
59 0.72
60 0.64
61 0.59
62 0.52
63 0.45
64 0.45
65 0.35
66 0.29
67 0.29
68 0.28
69 0.24
70 0.31
71 0.36
72 0.36
73 0.43
74 0.49
75 0.56
76 0.63
77 0.73
78 0.73
79 0.75
80 0.75
81 0.78
82 0.78
83 0.8
84 0.78
85 0.69
86 0.61
87 0.52
88 0.46
89 0.37
90 0.3
91 0.21
92 0.19
93 0.18
94 0.19
95 0.18
96 0.15
97 0.14
98 0.14
99 0.14
100 0.1
101 0.11
102 0.1
103 0.1
104 0.1
105 0.1
106 0.1
107 0.08
108 0.1
109 0.13
110 0.16
111 0.23
112 0.23
113 0.23
114 0.24
115 0.26
116 0.28
117 0.3
118 0.3
119 0.26
120 0.32
121 0.4
122 0.41
123 0.44
124 0.49
125 0.52
126 0.59