Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CHV4

Protein Details
Accession I1CHV4   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
154-178DSDERLARRVRKKKIRNGKELSLKEBasic
NLS Segment(s)
PositionSequence
160-172ARRVRKKKIRNGK
Subcellular Location(s) cyto 17, cyto_nucl 13.5, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR006083  PRK/URK  
IPR000764  Uridine_kinase-like  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004849  F:uridine kinase activity  
GO:0016310  P:phosphorylation  
GO:0044206  P:UMP salvage  
Pfam View protein in Pfam  
PF00485  PRK  
CDD cd02023  UMPK  
Amino Acid Sequences MSIDPTKYSDPNYFKVSLKTPMAIAIAGGADSGKKAFCDALTAKINKKYHARVALIRLTQFYRELTAEERVKYEAGNFYSDHPNAFDFELLGNTIKTLLSGKPTTVPEWDSSNHRRKGSYVIEPVDVILIEGTLVLYPKDIVNLMFMKVFIDEDSDERLARRVRKKKIRNGKELSLKEILMDYVDRVKPMYEEYILPSKKFADIVIPRGAENTIALQLMTNRVEEYLDSRYVLEEKKETSVANPGAAEILAQHIQSSYKHIPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.45
3 0.45
4 0.43
5 0.41
6 0.37
7 0.32
8 0.31
9 0.3
10 0.24
11 0.19
12 0.13
13 0.1
14 0.09
15 0.08
16 0.06
17 0.05
18 0.05
19 0.06
20 0.06
21 0.06
22 0.07
23 0.08
24 0.08
25 0.15
26 0.16
27 0.23
28 0.3
29 0.33
30 0.37
31 0.44
32 0.46
33 0.44
34 0.5
35 0.49
36 0.49
37 0.54
38 0.53
39 0.5
40 0.55
41 0.58
42 0.52
43 0.47
44 0.41
45 0.35
46 0.32
47 0.28
48 0.22
49 0.18
50 0.16
51 0.16
52 0.17
53 0.23
54 0.24
55 0.24
56 0.24
57 0.23
58 0.22
59 0.21
60 0.21
61 0.18
62 0.17
63 0.18
64 0.17
65 0.2
66 0.25
67 0.25
68 0.24
69 0.19
70 0.18
71 0.18
72 0.17
73 0.14
74 0.08
75 0.08
76 0.08
77 0.08
78 0.08
79 0.06
80 0.06
81 0.06
82 0.06
83 0.06
84 0.07
85 0.07
86 0.11
87 0.12
88 0.13
89 0.17
90 0.18
91 0.19
92 0.19
93 0.2
94 0.17
95 0.19
96 0.2
97 0.22
98 0.29
99 0.37
100 0.4
101 0.4
102 0.39
103 0.37
104 0.43
105 0.41
106 0.4
107 0.36
108 0.32
109 0.32
110 0.31
111 0.3
112 0.22
113 0.17
114 0.1
115 0.05
116 0.03
117 0.02
118 0.02
119 0.02
120 0.02
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.04
127 0.04
128 0.04
129 0.07
130 0.08
131 0.08
132 0.08
133 0.08
134 0.08
135 0.08
136 0.08
137 0.05
138 0.06
139 0.06
140 0.07
141 0.1
142 0.1
143 0.1
144 0.1
145 0.14
146 0.17
147 0.24
148 0.33
149 0.39
150 0.49
151 0.6
152 0.69
153 0.76
154 0.83
155 0.85
156 0.86
157 0.84
158 0.82
159 0.81
160 0.73
161 0.67
162 0.58
163 0.48
164 0.38
165 0.32
166 0.23
167 0.14
168 0.13
169 0.09
170 0.13
171 0.13
172 0.13
173 0.13
174 0.13
175 0.13
176 0.15
177 0.17
178 0.12
179 0.13
180 0.16
181 0.25
182 0.26
183 0.26
184 0.25
185 0.23
186 0.23
187 0.22
188 0.18
189 0.19
190 0.21
191 0.26
192 0.3
193 0.3
194 0.29
195 0.29
196 0.29
197 0.2
198 0.17
199 0.14
200 0.1
201 0.09
202 0.09
203 0.09
204 0.1
205 0.13
206 0.14
207 0.12
208 0.12
209 0.12
210 0.12
211 0.12
212 0.15
213 0.15
214 0.15
215 0.15
216 0.15
217 0.17
218 0.2
219 0.21
220 0.22
221 0.21
222 0.22
223 0.25
224 0.26
225 0.25
226 0.24
227 0.3
228 0.28
229 0.27
230 0.25
231 0.21
232 0.2
233 0.2
234 0.17
235 0.09
236 0.12
237 0.11
238 0.11
239 0.11
240 0.11
241 0.13
242 0.14
243 0.22