Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1C655

Protein Details
Accession I1C655   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-35NGPSVKFIFKKKPKKISPNTDKVQNAHydrophilic
NLS Segment(s)
PositionSequence
20-22KKP
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MTFKNLILTNGPSVKFIFKKKPKKISPNTDKVQNALTSKDFVEEIKSNEALVWGIDQDVTDIFTVGGSGSSSSKERIKKTSAKEYYHMRGLNLTTQECTQHHQHNQEDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.36
4 0.42
5 0.47
6 0.58
7 0.67
8 0.76
9 0.8
10 0.86
11 0.9
12 0.9
13 0.9
14 0.89
15 0.84
16 0.81
17 0.72
18 0.62
19 0.55
20 0.47
21 0.37
22 0.3
23 0.26
24 0.2
25 0.19
26 0.18
27 0.15
28 0.12
29 0.15
30 0.14
31 0.16
32 0.17
33 0.17
34 0.16
35 0.15
36 0.15
37 0.11
38 0.09
39 0.07
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.03
55 0.04
56 0.04
57 0.06
58 0.07
59 0.1
60 0.16
61 0.21
62 0.25
63 0.29
64 0.36
65 0.42
66 0.48
67 0.57
68 0.6
69 0.58
70 0.6
71 0.63
72 0.61
73 0.6
74 0.54
75 0.44
76 0.39
77 0.37
78 0.37
79 0.34
80 0.29
81 0.24
82 0.24
83 0.28
84 0.25
85 0.28
86 0.29
87 0.34
88 0.4
89 0.46