Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CC00

Protein Details
Accession I1CC00   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MKIHWNERNHCRHQQRKQVIIHHEWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR014752  Arrestin-like_C  
IPR011021  Arrestin-like_N  
IPR011022  Arrestin_C-like  
Pfam View protein in Pfam  
PF02752  Arrestin_C  
PF00339  Arrestin_N  
Amino Acid Sequences MKIHWNERNHCRHQQRKQVIIHHEWKFLEPQKKLHHLLPTTYLYPFELALPGDLAESFESYSFGSLSYKLKATVERPAFLPNLISRKQFWIIRQPSDALVGTIPVQISNEWADHLHYTITIPSKRYNRGQDITIDFALMPAHPGFSVRYLSCFLKEYISCCDTHTESRIIRFFRDDQFPSPFKTETITVPSSPIAIQTDSDNAYVRIQHKLNFTMSIADEQGELTEFRASMPIEIVDREDGNELPSYENASQSTHYSPLYLSSSPEDSYPITPSSSSSTGQDYFTLQPNIYHNECSRVPSYHTINLEEGLPAYEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.85
4 0.85
5 0.84
6 0.81
7 0.8
8 0.79
9 0.72
10 0.68
11 0.6
12 0.54
13 0.53
14 0.53
15 0.53
16 0.47
17 0.51
18 0.54
19 0.61
20 0.63
21 0.6
22 0.6
23 0.54
24 0.54
25 0.52
26 0.48
27 0.42
28 0.38
29 0.34
30 0.26
31 0.24
32 0.21
33 0.15
34 0.12
35 0.1
36 0.1
37 0.1
38 0.09
39 0.09
40 0.08
41 0.08
42 0.07
43 0.08
44 0.07
45 0.07
46 0.08
47 0.07
48 0.08
49 0.07
50 0.07
51 0.08
52 0.1
53 0.12
54 0.14
55 0.15
56 0.15
57 0.17
58 0.21
59 0.22
60 0.29
61 0.3
62 0.29
63 0.29
64 0.31
65 0.3
66 0.26
67 0.27
68 0.21
69 0.25
70 0.26
71 0.26
72 0.24
73 0.28
74 0.33
75 0.33
76 0.33
77 0.37
78 0.4
79 0.42
80 0.42
81 0.39
82 0.34
83 0.34
84 0.31
85 0.2
86 0.15
87 0.12
88 0.1
89 0.1
90 0.1
91 0.07
92 0.07
93 0.07
94 0.08
95 0.09
96 0.08
97 0.08
98 0.08
99 0.09
100 0.09
101 0.09
102 0.08
103 0.07
104 0.07
105 0.09
106 0.14
107 0.15
108 0.16
109 0.22
110 0.27
111 0.32
112 0.38
113 0.42
114 0.44
115 0.45
116 0.44
117 0.43
118 0.41
119 0.39
120 0.33
121 0.26
122 0.18
123 0.16
124 0.15
125 0.1
126 0.08
127 0.05
128 0.05
129 0.05
130 0.06
131 0.06
132 0.07
133 0.1
134 0.09
135 0.1
136 0.13
137 0.14
138 0.14
139 0.15
140 0.14
141 0.15
142 0.15
143 0.15
144 0.17
145 0.18
146 0.17
147 0.16
148 0.18
149 0.17
150 0.18
151 0.19
152 0.18
153 0.18
154 0.21
155 0.24
156 0.22
157 0.21
158 0.23
159 0.23
160 0.23
161 0.29
162 0.27
163 0.27
164 0.32
165 0.32
166 0.32
167 0.31
168 0.28
169 0.22
170 0.22
171 0.2
172 0.16
173 0.21
174 0.2
175 0.17
176 0.18
177 0.18
178 0.17
179 0.15
180 0.15
181 0.1
182 0.09
183 0.09
184 0.09
185 0.11
186 0.11
187 0.12
188 0.12
189 0.11
190 0.11
191 0.14
192 0.15
193 0.18
194 0.18
195 0.21
196 0.24
197 0.26
198 0.27
199 0.25
200 0.24
201 0.21
202 0.2
203 0.18
204 0.15
205 0.13
206 0.11
207 0.1
208 0.1
209 0.08
210 0.07
211 0.06
212 0.07
213 0.07
214 0.07
215 0.09
216 0.09
217 0.09
218 0.1
219 0.1
220 0.1
221 0.1
222 0.11
223 0.1
224 0.1
225 0.11
226 0.11
227 0.11
228 0.11
229 0.12
230 0.12
231 0.12
232 0.12
233 0.16
234 0.15
235 0.16
236 0.16
237 0.16
238 0.16
239 0.18
240 0.2
241 0.18
242 0.17
243 0.16
244 0.15
245 0.17
246 0.2
247 0.18
248 0.17
249 0.18
250 0.2
251 0.2
252 0.2
253 0.19
254 0.17
255 0.18
256 0.19
257 0.17
258 0.16
259 0.16
260 0.17
261 0.21
262 0.22
263 0.21
264 0.2
265 0.24
266 0.24
267 0.25
268 0.24
269 0.22
270 0.22
271 0.27
272 0.28
273 0.23
274 0.25
275 0.28
276 0.33
277 0.32
278 0.34
279 0.29
280 0.33
281 0.34
282 0.36
283 0.35
284 0.32
285 0.35
286 0.37
287 0.42
288 0.43
289 0.44
290 0.43
291 0.41
292 0.39
293 0.34
294 0.27
295 0.22