Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CTF6

Protein Details
Accession I1CTF6    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-34TATKDTKKTAPKDSSKKKRISRRETYSSYIHydrophilic
NLS Segment(s)
PositionSequence
12-26KTAPKDSSKKKRISR
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MAAETATKDTKKTAPKDSSKKKRISRRETYSSYIYKVLKQVHPDTGISNKAMSILNSFVNDIFERIASEASKLAAYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.62
3 0.72
4 0.79
5 0.84
6 0.84
7 0.88
8 0.87
9 0.88
10 0.89
11 0.87
12 0.87
13 0.85
14 0.85
15 0.8
16 0.76
17 0.72
18 0.63
19 0.55
20 0.5
21 0.42
22 0.35
23 0.35
24 0.36
25 0.32
26 0.35
27 0.35
28 0.34
29 0.35
30 0.33
31 0.3
32 0.27
33 0.26
34 0.21
35 0.18
36 0.14
37 0.13
38 0.13
39 0.11
40 0.1
41 0.09
42 0.1
43 0.1
44 0.1
45 0.08
46 0.09
47 0.09
48 0.08
49 0.07
50 0.06
51 0.06
52 0.06
53 0.07
54 0.06
55 0.07
56 0.07
57 0.07
58 0.07
59 0.07
60 0.11
61 0.16
62 0.19
63 0.22
64 0.24
65 0.25
66 0.26
67 0.29
68 0.3
69 0.31
70 0.33
71 0.31
72 0.32
73 0.31
74 0.31
75 0.3
76 0.27
77 0.21
78 0.17
79 0.14
80 0.11
81 0.11
82 0.12
83 0.1
84 0.09
85 0.09
86 0.1
87 0.1
88 0.1
89 0.09
90 0.1
91 0.1
92 0.11
93 0.11
94 0.13
95 0.16
96 0.16
97 0.18
98 0.18