Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1CPR1

Protein Details
Accession I1CPR1    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
45-67WNRLDAKIKEDKKKRPSTGQMNSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_mito 11.166, mito 10.5, cyto 10.5, cyto_nucl 8.333, nucl 4
Family & Domain DBs
Amino Acid Sequences MAKNSSFGESSESTGMHAAFGTSAGDFGVVHVVHFKEFSIFFVSWNRLDAKIKEDKKKRPSTGQMNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.12
4 0.1
5 0.07
6 0.06
7 0.06
8 0.06
9 0.04
10 0.04
11 0.04
12 0.04
13 0.04
14 0.04
15 0.07
16 0.06
17 0.06
18 0.08
19 0.08
20 0.08
21 0.08
22 0.08
23 0.07
24 0.07
25 0.08
26 0.11
27 0.11
28 0.12
29 0.16
30 0.19
31 0.17
32 0.19
33 0.2
34 0.18
35 0.22
36 0.22
37 0.24
38 0.31
39 0.39
40 0.47
41 0.54
42 0.62
43 0.69
44 0.79
45 0.8
46 0.81
47 0.83