Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1C4T5

Protein Details
Accession I1C4T5   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
63-88WFQNRRAKENKKKKVFQQQLKQKKSQHydrophilic
NLS Segment(s)
PositionSequence
68-76RAKENKKKK
Subcellular Location(s) nucl 13, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001356  Homeobox_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00046  Homeodomain  
PROSITE View protein in PROSITE  
PS50071  HOMEOBOX_2  
CDD cd00086  homeodomain  
Amino Acid Sequences MDKVVTPTQMISLSTVARRRMRTSKEEMAVLDEYYRKNPNPNQEEKKEIANLLKMGTKNVHFWFQNRRAKENKKKKVFQQQLKQKKSQQTSIPSSSKQKQHYLRSTTNTNTSSKQQQEDSDTQPLQLPPISDIM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.3
4 0.34
5 0.37
6 0.42
7 0.49
8 0.53
9 0.56
10 0.59
11 0.61
12 0.58
13 0.56
14 0.5
15 0.45
16 0.39
17 0.32
18 0.26
19 0.2
20 0.18
21 0.2
22 0.23
23 0.2
24 0.26
25 0.3
26 0.38
27 0.43
28 0.52
29 0.57
30 0.56
31 0.61
32 0.55
33 0.54
34 0.45
35 0.39
36 0.32
37 0.26
38 0.22
39 0.18
40 0.2
41 0.17
42 0.17
43 0.17
44 0.16
45 0.18
46 0.18
47 0.22
48 0.19
49 0.21
50 0.29
51 0.37
52 0.42
53 0.4
54 0.43
55 0.47
56 0.57
57 0.65
58 0.67
59 0.68
60 0.71
61 0.75
62 0.78
63 0.81
64 0.81
65 0.8
66 0.79
67 0.8
68 0.81
69 0.82
70 0.8
71 0.75
72 0.73
73 0.69
74 0.65
75 0.61
76 0.59
77 0.6
78 0.61
79 0.58
80 0.53
81 0.56
82 0.56
83 0.56
84 0.52
85 0.54
86 0.55
87 0.61
88 0.67
89 0.68
90 0.67
91 0.66
92 0.67
93 0.62
94 0.61
95 0.54
96 0.48
97 0.43
98 0.42
99 0.45
100 0.43
101 0.44
102 0.39
103 0.41
104 0.46
105 0.48
106 0.48
107 0.47
108 0.43
109 0.39
110 0.4
111 0.37
112 0.31
113 0.28
114 0.23