Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BYP7

Protein Details
Accession I1BYP7    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
155-180YFYLRQREYSKKLKKKEANEKMKVLQHydrophilic
NLS Segment(s)
PositionSequence
109-130EKTEEKKEEKEEEKEEEKKEKK
167-170LKKK
Subcellular Location(s) mito_nucl 11.999, mito 11.5, nucl 11, cyto_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MTSFQNLYVARLITNERPCFVCSKFTNVVLTLADNSNKDWFSICKVHLGDFNFCTKLGGVKEPKVVKKEHKGQPESDSVSDLVSTIGSAWKSWRSKGTTEEEKTEKKEEKTEEKKEEKEEEKEEEKKEKKEEGMVKESSPVQQQQPVRFILQKDYFYLRQREYSKKLKKKEANEKMKVLQFPEVPKDLPSLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.32
4 0.34
5 0.35
6 0.37
7 0.35
8 0.36
9 0.29
10 0.35
11 0.37
12 0.37
13 0.38
14 0.35
15 0.35
16 0.27
17 0.26
18 0.2
19 0.19
20 0.18
21 0.16
22 0.17
23 0.19
24 0.18
25 0.17
26 0.17
27 0.16
28 0.2
29 0.24
30 0.23
31 0.26
32 0.27
33 0.28
34 0.3
35 0.32
36 0.3
37 0.27
38 0.3
39 0.24
40 0.23
41 0.22
42 0.18
43 0.19
44 0.17
45 0.22
46 0.23
47 0.25
48 0.32
49 0.36
50 0.4
51 0.4
52 0.42
53 0.42
54 0.48
55 0.55
56 0.56
57 0.6
58 0.59
59 0.58
60 0.58
61 0.56
62 0.5
63 0.4
64 0.34
65 0.25
66 0.22
67 0.19
68 0.14
69 0.09
70 0.06
71 0.05
72 0.04
73 0.05
74 0.05
75 0.05
76 0.07
77 0.13
78 0.14
79 0.16
80 0.21
81 0.22
82 0.24
83 0.29
84 0.35
85 0.37
86 0.38
87 0.41
88 0.4
89 0.4
90 0.41
91 0.41
92 0.38
93 0.31
94 0.35
95 0.35
96 0.41
97 0.48
98 0.53
99 0.57
100 0.58
101 0.59
102 0.58
103 0.6
104 0.54
105 0.5
106 0.45
107 0.42
108 0.43
109 0.45
110 0.44
111 0.47
112 0.47
113 0.47
114 0.48
115 0.46
116 0.42
117 0.45
118 0.49
119 0.46
120 0.47
121 0.44
122 0.4
123 0.38
124 0.38
125 0.32
126 0.28
127 0.24
128 0.2
129 0.25
130 0.29
131 0.31
132 0.34
133 0.34
134 0.33
135 0.34
136 0.33
137 0.36
138 0.36
139 0.33
140 0.33
141 0.37
142 0.39
143 0.41
144 0.46
145 0.4
146 0.43
147 0.47
148 0.53
149 0.54
150 0.6
151 0.65
152 0.68
153 0.75
154 0.78
155 0.81
156 0.83
157 0.87
158 0.87
159 0.87
160 0.85
161 0.83
162 0.79
163 0.77
164 0.69
165 0.6
166 0.55
167 0.49
168 0.46
169 0.46
170 0.42
171 0.37
172 0.35
173 0.37